DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr1

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001286645.1 Gene:dpr1 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster

Alignment Length:340 Identity:79/341 (23%)
Similarity:114/341 (33%) Gaps:101/341 (30%)


Human     3 WCLG-LAVLSLVISQGADGRGKPEVVSVVGRAGESVVLGCDLLPPAGRPPLHVIEWLRFGFLLPI 66
            |.:| |.:||:|:.:|.:....|                        .||......:....|||.
  Fly    14 WLIGWLLLLSMVLLRGYNAALAP------------------------TPPTTSTTTISPSNLLPY 54

Human    67 FIQFGLYSPRIDPDYVGRVRLQKG-ASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFANGSWVHL 130
            | .|.:  ||.....||    |.| ...::|.|..:|..|...|    |.||..   |.|:    
  Fly    55 F-DFDV--PRNLTVTVG----QTGFLHCRVERLGDKDVSWIRKR----DLHILT---AGGT---- 101

Human   131 TVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLGQGQGQVQVQNGTLRIRR 195
            |..|..:||...|                 .||                       .|.||:|:.
  Fly   102 TYTSDQRFQVLRP-----------------DGS-----------------------ANWTLQIKY 126

Human   196 VERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLACHAEAYPANL-TY 259
            .:...||||.||. :||...:.:....|:.....:..|.:..|....|::|.|.....|..| ..
  Fly   127 PQPRDSGVYECQI-NTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNI 190

Human   260 SWFQ-----DNINVFHISRLQPRVRI---LVDG---SLRLLATQPDDAGCYTCVPSNGLLHPPSA 313
            .|::     |......|.....|:|:   ..||   .|::....|.|.|.|||||:..    .::
  Fly   191 FWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVA----KTS 251

Human   314 SAYLTVLYPAQVTAM 328
            |.|:.|:......||
  Fly   252 SVYVHVIIGEHPAAM 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 25/109 (23%)
IG_like 28..110 CDD:214653 18/83 (22%)
I-set 136..223 CDD:254352 17/87 (20%)
Ig 154..220 CDD:143165 14/66 (21%)
Ig_3 226..305 CDD:290638 23/91 (25%)
IG_like 233..319 CDD:214653 25/98 (26%)
Ig 341..404 CDD:299845
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr1NP_001286645.1 Ig 59..154 CDD:299845 36/153 (24%)
IG_like 60..150 CDD:214653 35/146 (24%)
IG_like 163..257 CDD:214653 25/98 (26%)
Ig 174..244 CDD:143165 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.