DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9 and dpr9

Sequence 1:NP_001128522.1 Gene:IGSF9 HGNCID:18132 Length:1179 Species:Homo sapiens
Sequence 2:NP_001287332.1 Gene:dpr9 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster

Alignment Length:236 Identity:53/237 (22%)
Similarity:85/237 (36%) Gaps:76/237 (32%)


Human   183 QVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQDVSLA 247
            |.|.::..|:|:..:...||:|.||.|:|. ..:|...|.|:.|...::...:..:.:...::|.
  Fly   321 QPQTEDWMLQIKYPQHRDSGIYECQVSTTP-HMSHYIHLNVV
EPSTEIIGAPDLYIESGSTINLT 384

Human   248 CHAEAYPANLTYSWFQDNINVF--H---ISRLQPRVRILV--------DGSLRLLATQPDDAGCY 299
            |..:..|....|.::..| |.|  |   |:...||..:.|        ...|.:.:.:|.|:|.|
  Fly   385 CIIQNSPEPPAYIFWNHN-NAFPSHPQIINYDSPRGGVSVVTNKGDTTTSFLLIKSARPSDSGHY 448

Human   300 TCVPS------------NGLLHP-----PSASA------------------------------YL 317
            .|.||            ||:.|.     ||::|                              ::
  Fly   449 QCNPSNAKPKSVTVHVLNGVSHSVSRGVPSSNAARGTSASSPLAHSLSVCVPVCVLLQLGACRWI 513

Human   318 TVLYPAQVTAMPP---------ETPLPIGMPGV--IRCPVR 347
            ..|..|.:...||         |.|   |.||.  |.|.:|
  Fly   514 AALLGAALATPPPLRSTRRATGERP---GSPGCAPIACDMR 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9NP_001128522.1 Ig 24..132 CDD:299845
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 13/40 (33%)
Ig 154..220 CDD:143165 12/37 (32%)
Ig_3 226..305 CDD:290638 21/104 (20%)
IG_like 233..319 CDD:214653 26/146 (18%)
Ig 341..404 CDD:299845 3/10 (30%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
FN3 625..715 CDD:238020
PDZ-binding. {ECO:0000250} 1177..1179
dpr9NP_001287332.1 Ig 263..361 CDD:299845 14/41 (34%)
IG_like 263..360 CDD:214653 13/40 (33%)
IG_like 371..464 CDD:214653 20/94 (21%)
IGc2 377..456 CDD:197706 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.