DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and CG13506

DIOPT Version :10

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:294 Identity:71/294 - (24%)
Similarity:115/294 - (39%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   433 EGKPG---YLDC------LTQATPKPTVVWYRNQMLISE-----DSRFEVFKNGTLRINSVEVYD 483
            |.|||   .|:|      |:.|     ||||:|:::|:.     ..|.:...|.::.:.:|...|
  Fly    80 EAKPGDDVILNCDARNFQLSNA-----VVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPED 139

Human   484 GTWYRC----MSSTPAGSIEAQARVQVL-EKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIK 543
            ...|.|    .......::...||:.:| :....|...|..:..:..|   :.|.....:..|||
  Fly   140 SDDYYCE
ILPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHK---LECRTYLPDNATIK 201

Human   544 WERADGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNG----PQGQIRAHVQLTVAVFITFKV 604
            |...|.:..|..|.:..|.:....|...:||:|.|:|.:|    |.|.:...||.:..|    ..
  Fly   202 WSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLA
DDGSRHPPHGTVHIDVQYSPIV----ST 262

Human   605 EPERTTVYQGHTALLQCEAQGDP--KPLIQWKGKD-RILDPTKLGPRMHIFQN-GSLVIHDVAPE 665
            ........:|.||.|.|..:..|  :......||. ::.|...|...:|...| .:|::.:|...
  Fly   263 HRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDS 327

Human   666 DSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESE 699
            |.|.|.|...|:  |...|..::|...|...:.|
  Fly   328 DLGEYLCQVENA--IGSNEVKVHVSYNPETPQFE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 Ig_3 41..112 CDD:464046
Ig2_PTK7 136..230 CDD:409417
Ig strand B 154..158 CDD:409417
Ig strand C 167..171 CDD:409417
Ig strand E 191..195 CDD:409417
Ig strand F 205..210 CDD:409417
Ig strand G 217..220 CDD:409417
Ig_3 234..310 CDD:464046
Ig 337..409 CDD:472250
Ig strand C 361..365 CDD:409389
Ig strand E 382..386 CDD:409389
Ig strand F 396..401 CDD:409389
Ig 420..506 CDD:472250 22/90 (24%)
Ig strand B 437..441 CDD:409353 2/6 (33%)
Ig strand C 450..454 CDD:409353 2/3 (67%)
Ig strand E 472..476 CDD:409353 0/3 (0%)
Ig strand F 486..491 CDD:409353 2/8 (25%)
Ig strand G 499..502 CDD:409353 0/2 (0%)
Ig 528..592 CDD:409353 18/67 (27%)
Ig strand B 528..532 CDD:409353 0/3 (0%)
Ig strand C 541..545 CDD:409353 3/3 (100%)
Ig strand E 561..565 CDD:409353 1/3 (33%)
Ig strand F 575..580 CDD:409353 2/4 (50%)
Ig strand G 589..592 CDD:409353 0/2 (0%)
Ig_3 601..676 CDD:464046 18/78 (23%)
PTK_CCK4 798..1071 CDD:133178
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 19/70 (27%)
Ig_3 173..238 CDD:464046 17/67 (25%)
Ig 258..349 CDD:472250 22/96 (23%)
Ig strand B 275..279 CDD:409353 2/3 (67%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.