DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTK7 and wrapper

DIOPT Version :10

Sequence 1:NP_001257327.1 Gene:PTK7 / 5754 HGNCID:9618 Length:1078 Species:Homo sapiens
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:468 Identity:102/468 - (21%)
Similarity:162/468 - (34%) Gaps:122/468 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   154 VTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAG--------PEHSGLYSCCA 210
            |.|.|.:: .|....:|.||...|.|  |.|........:.|.|.|        ...:|.|.|..
  Fly    52 VQLPCTLN-TPFRYVRWHRDDVALVD--SRHPELPPPDRIMLWPNGSLQVANVQSSDTGDYYCEM 113

Human   211 HSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYEEAMFH--CQFSAQPPPSLQWLFEDET- 272
            :|..|.........:.:|.:    |::.|.|:...|. .|:|.  |:....|.|.:.|...... 
  Fly   114 NSDSG
HVVQQHAIEVQLAPQ----VLIEPSDLTEQRI-GAIFEVVCEAQGVPQPVITWRLNGNVI 173

Human   273 -PITNRSRPPHLRRATVFANGSLLLTQVRPRN-AGIYRCIGQGQRGPPIILEATLHLAEIEDMPL 335
             |.:|.            .|...|:.:::.|| ||:..|:.....|.|.:....||:....::.:
  Fly   174 QPQSNT------------GNRQSLILEIKSRNQAGLIECVASNGVGEPAVANVYLHVLFSPEVSI 226

Human   336 FEPRVFT-AGSEERVTCLPPKGLPEPSVWWEHAG--VRLPTHGRVYQK---------------GH 382
            .:|.|:| .||...:.|: .:..|..:|.|.|.|  |.|..|...::.               .|
  Fly   227 PQPVVYTKLGSRAHLECI-VEAAPAATVKWFHHGLPVALGAHSTTHESELQTNRSVDHYVNAVRH 290

Human   383 ELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQDSQLEEGKPGYLDCLTQATP 447
            .||:.::..:|.|.|.|.|:|....:...|.:|...:|...|.         .||     ||::.
  Fly   291 MLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMPCLFKI---------NPG-----TQSST 341

Human   448 KPTVVWYRNQML-ISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSIEAQARVQVLEKLK 511
            ...:||....:| |.|      ||   |:...:              |:.::..|.|.      .
  Fly   342 SHVLVWQTESLLPIME------FK---LKFRQI--------------PSNNVTRQVRT------N 377

Human   512 FTPPPQPQQCMEFDKEATVPCSATGR--EKPTIKWERADGSSLPE----------WVTDNAGTLH 564
            :|             |.|:|..||..  ...|........:||.|          | :||:..:.
  Fly   378 WT-------------ELTIPAQATNGLIYITTYTLHGLQPASLYEVSVLARNSFGW-SDNSKIVR 428

Human   565 FARVTRDDAGNYT 577
            ||.....:..||:
  Fly   429 FATGGEVELPNYS 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTK7NP_001257327.1 Ig_3 41..112 CDD:464046
Ig2_PTK7 136..230 CDD:409417 20/83 (24%)
Ig strand B 154..158 CDD:409417 2/3 (67%)
Ig strand C 167..171 CDD:409417 0/3 (0%)
Ig strand E 191..195 CDD:409417 0/3 (0%)
Ig strand F 205..210 CDD:409417 2/4 (50%)
Ig strand G 217..220 CDD:409417 0/2 (0%)
Ig_3 234..310 CDD:464046 18/80 (23%)
Ig 337..409 CDD:472250 23/89 (26%)
Ig strand C 361..365 CDD:409389 1/3 (33%)
Ig strand E 382..386 CDD:409389 2/3 (67%)
Ig strand F 396..401 CDD:409389 2/4 (50%)
Ig 420..506 CDD:472250 17/86 (20%)
Ig strand B 437..441 CDD:409353 1/3 (33%)
Ig strand C 450..454 CDD:409353 1/3 (33%)
Ig strand E 472..476 CDD:409353 1/3 (33%)
Ig strand F 486..491 CDD:409353 0/4 (0%)
Ig strand G 499..502 CDD:409353 0/2 (0%)
Ig 528..592 CDD:409353 15/62 (24%)
Ig strand B 528..532 CDD:409353 1/3 (33%)
Ig strand C 541..545 CDD:409353 1/3 (33%)
Ig strand E 561..565 CDD:409353 0/3 (0%)
Ig strand F 575..580 CDD:409353 2/3 (67%)
Ig strand G 589..592 CDD:409353
Ig_3 601..676 CDD:464046
PTK_CCK4 798..1071 CDD:133178
wrapperNP_477404.1 IG_like 41..118 CDD:214653 18/68 (26%)
Ig strand B 52..56 CDD:409353 2/3 (67%)
Ig strand C 64..68 CDD:409353 0/3 (0%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 133..219 CDD:472250 23/102 (23%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 0/3 (0%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 22/89 (25%)
FN3 339..431 CDD:238020 25/134 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.