DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTGS2 and cd

Sequence 1:NP_000954.1 Gene:PTGS2 HGNCID:9605 Length:604 Species:Homo sapiens
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:574 Identity:118/575 (21%)
Similarity:197/575 (34%) Gaps:159/575 (28%)


Human   102 VLTSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEK 166
            |..::.|    |.||.|          |.:.|.....|...|....| .|....:||.:.::  .
  Fly   224 VCNNKQH----PRTYGA----------SMVPYRRMVSPDYADGIAAP-RVSHHGRLPPARQV--S 271

Human   167 LLLRRKFIPDPQGSNMMFAFFAQHFTHQFFKT--------------------DH----------- 200
            |.:.|..........:|.|.|.|...|....|                    .|           
  Fly   272 LKIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVDILPD 336

Human   201 ---------------KRGPAFTNGLGHGVDLNH---------IYGETLARQRKLRLFKDGKMKYQ 241
                           :..||.|...|..:.||.         :||....||.:||.|.:|.::..
  Fly   337 DPYYKQYNISCMNFVRSAPAPTGRFGPRMQLNQATAFIDASVVYGNLEQRQNQLRSFINGSLRMF 401

Human   242 II-DGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVF---------GLVPGLMMYATIWLREHN 296
            :. ||....| :....|:.....|:..     :|:..|         .|:  |.....:|.|.||
  Fly   402 VTDDGRQLLP-ISSNPADGCNRVQMTR-----LGKYCFESGDDRANENLL--LTSMHLLWARHHN 458

Human   297 RVCDVLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKL---------------K 346
            .:...|::::|.|.||:|:|.:|.||..:...|...:::..|.|.:...               .
  Fly   459 YLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDT 523

Human   347 FDPEL------LFNKQFQYQNRIAAEFNTLYHWHPLLPDTFQIH-----DQKYNYQQFIYNN-SI 399
            :|||:      .|         .||.|...   |.|||..|.|.     .:.....:.::|. |:
  Fly   524 YDPEVDPSIANCF---------AAAAFRFA---HTLLPGLFNISRDNSTPEAIELHKMLFNPFSL 576

Human   400 LLEHGI------------TQFVESFTRQIAGRVAGGR---NVPPAVQKVSQASIDQSRQMKYQSF 449
            ..||||            .|....|:.::..::..|.   .||.....:...:|.:.|.....|:
  Fly   577 WAEHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPLCGLDLVSLNIQRGRDHGIPSY 641

Human   450 NEYRKRFMLKPYESFEELTGEKEMSAELEA---LYGDIDAVELYPALLVEKPRPDAIFGETMVEV 511
            ..:|:...|...:::||::...: :|.|::   :|.....|::|...|.|.|...||||..:..:
  Fly   642 PVFRRHCRLPTVDTWEEMSQAID-NATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCM 705

Human   512 GAPFSLKGLMGNVICSPAYW-----KPSTFGGEVGFQIINTASIQSLICNNVKG 560
            .:...|:..:|:     ::|     .|..|......:|..| |:.::||.|..|
  Fly   706 VSDQFLRLKLGD-----SHWYERKMGPQKFTKAQLAEIYKT-SLAAIICRNSDG 753

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTGS2NP_000954.1 EGF_CA 19..54 CDD:238011
prostaglandin_endoperoxide_synthase 75..562 CDD:188648 118/575 (21%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 118/575 (21%)
peroxinectin_like 364..750 CDD:188655 89/413 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.