DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PTGS1 and cd

Sequence 1:NP_000953.2 Gene:PTGS1 HGNCID:9604 Length:599 Species:Homo sapiens
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:593 Identity:124/594 (21%)
Similarity:207/594 (35%) Gaps:171/594 (29%)


Human    78 RNSLRPSPSFTHFLLTHGRWFWEFVNATFIR-----EMLMRLVLTVRS--------NLIPSPPTY 129
            |:|.....:||..|...|::....:.||.:.     |.:...|...|.        :::|..|.|
  Fly   276 RSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEGESIDCCVAATREQHPECYPVDILPDDPYY 340

Human   130 NSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTN 194
            ...:  ||..:|             .:..|.|.|..|    |..||                  |
  Fly   341 KQYN--ISCMNF-------------VRSAPAPTGRFG----PRMQL------------------N 368

Human   195 LMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDG- 258
            ...||                           :|...:||:..:||.|||.|.:|.|:..|.|. 
  Fly   369 QATAF---------------------------IDASVVYGNLEQRQNQLRSFINGSLRMFVTDDG 406

Human   259 -EMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFG----------LLPGLMLYATLWLREHNRVC 312
             ::.|.|...|.       |........:|:..|.          ||..:.|   ||.|.||.:.
  Fly   407 RQLLPISSNPAD-------GCNRVQMTRLGKYCFESGDDRANENLLLTSMHL---LWARHHNYLA 461

Human   313 DLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGY-------FLQLK--------FDP 362
            ..|:.::|.|.||:|:|..|.||..:...|...|::..|.|.       .|..|        :||
  Fly   462 RQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLLPAKHNLNAPDTYDP 526

Human   363 EL-------LFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYE-----QFLFNT-SMLV 414
            |:       .....|::.             |.|:|..|.:.....:.|     :.|||. |:..
  Fly   527 EVDPSIANCFAAAAFRFA-------------HTLLPGLFNISRDNSTPEAIELHKMLFNPFSLWA 578

Human   415 DYGVE-ALVDA-----------FSRQIAGRIGGGRNMDHHILHVAVDV----IRESREMRLQPFN 463
            ::|:: ||:.|           ||.::..::..|...|...| ..:|:    |:..|:..:..:.
  Fly   579 EHGIDHALMTAANTPVMQVDRFFSLEVTQKLFEGTAEDRVPL-CGLDLVSLNIQRGRDHGIPSYP 642

Human   464 EYRKRFGMKPYTSFQELVGEKEMAA--ELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGA 526
            .:|:...:....:::|:....:.|.  .:.::|.....::.|.|.|.|.....:|||..:..:.:
  Fly   643 VFRRHCRLPTVDTWEEMSQAIDNATLDSIRQIYESPQDVDVYTGALSEPPLDGAIFGPLLSCMVS 707

Human   527 PFSLKGLLGNPICSPEYW-----KPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQ 586
            ...|:..||:     .:|     .|..|.......|.|| :|..::|.|:.....|...|....:
  Fly   708 DQFLRLKLGD-----SHWYERKMGPQKFTKAQLAEIYKT-SLAAIICRNSDGITRVREHVMQRLR 766

Human   587 DDG-PAVE 593
            |.| |.|:
  Fly   767 DGGNPHVD 774

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PTGS1NP_000953.2 EGF_CA 32..69 CDD:238011
prostaglandin_endoperoxide_synthase 89..575 CDD:188648 114/562 (20%)
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 118/573 (21%)
peroxinectin_like 364..750 CDD:188655 95/461 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.