DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and PMA1

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_011507.1 Gene:PMA1 SGDID:S000002976 Length:918 Species:Saccharomyces cerevisiae

Alignment Length:937 Identity:248/938 (26%)
Similarity:404/938 (43%) Gaps:205/938 (22%)


  Fly    27 DVETDN-------HKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNILTPQPPT--PKWIVFL 82
            |.::||       ...||.|  |.|:|||:.||:..|...|.:..|.|.:..:..:  .|:::| 
Yeast    58 DEDSDNDGPVAAGEARPVPE--EYLQTDPSYGLTSDEVLKRRKKYGLNQMADEKESLVVKFVMF- 119

  Fly    83 KTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIVTGLFTYFQVHKSSSIM 147
              ..|....::.|.:.|. .|.           .|.:..|:...:|::..|: .:.|..::.||:
Yeast   120 --FVGPIQFVMEAAAILA-AGL-----------SDWVDFGVICGLLMLNAGV-GFVQEFQAGSIV 169

  Fly   148 DSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRIL-EAHGLKVDNSSLTGES 211
            |..|..:...|.|||:|::..:.::|:|.|||::::.|..:|.|.||: |...|::|.|::||||
Yeast   170 DELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGES 234

  Fly   212 EPQVRSTEFTHENPLETKNLA---------FFSTNVLEGTCRGVVIATGDSTVMGRIA---NLAA 264
                               ||         |.|:.|..|....||.||||:|.:||.|   |.||
Yeast   235 -------------------LAVDKHYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAA 280

  Fly   265 G----LDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGL 325
            |    ..:|.:.|.  |.|.:..|....::....|:.   |.|  .:..:.:.:||.:..||.||
Yeast   281 GGQGHFTEVLNGIG--IILLVLVIATLLLVWTACFYR---TNG--IVRILRYTLGITIIGVPVGL 338

  Fly   326 LVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESD 390
            ...||..:.:.|..:|.|..:|:.|.|:|:|.....:|||||||||:|:::: |           
Yeast   339 PAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSL-H----------- 391

  Fly   391 TTESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNG-NASEAALLKFTETIFA 454
                   ..:.:|..|.:.|.:.|.|..|.:.||.......|.|.:.. ..::.||.|:      
Yeast   392 -------EPYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLKQYPKAKDALTKY------ 443

  Fly   455 GIGAFRQKHIKLTEI-PFNSTEKYQVSVHEFNSSDGYFIVEMKGAPERILDRCSTIIIQGLSVE- 517
                      |:.|. ||:...|...:|.|  |.:|..||.:||||..:|.          :|| 
Yeast   444 ----------KVLEFHPFDPVSKKVTAVVE--SPEGERIVCVKGAPLFVLK----------TVEE 486

  Fly   518 ---LTPTLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISL 579
               :...:...:|....|:...|.|.||.|     ..:....:|              .||::..
Yeast   487 DHPIPEDVHENYENKVAELASRGFRALGVA-----RKRGEGHWE--------------ILGVMPC 532

  Fly   580 IDPPRAAVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIITTPTAEDIAKQRGVTVLDIDSR 644
            :||||......|::.|..|:||.|:|||          :|||     |::..:|.|   |..:..
Yeast   533 MDPPRDDTAQTVSEARHLGLRVKMLTGD----------AVGI-----AKETCRQLG---LGTNIY 579

  Fly   645 QATAIVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSP 709
            .|..:.:.||  .:|...||  ..:..|...||...||.|..:||..|.||.:||:|||||||:|
Yeast   580 NAERLGLGGG--GDMPGSEL--ADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAP 640

  Fly   710 ALKRADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLP-EI 773
            :||:||.|:|:. ..:|.::.|||::.|....::|:..::..|.||..:...:.|.:..:|. ||
Yeast   641 SLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLHLEI 704

  Fly   774 VPFLFFVIFDIPLALGTIAILCI--DIGTDMLPAISLAYEKA---ESDIMARMPRDPFEDRLVNK 833
            ...|:..|.|..|.:..|..:.|  |:.|     :::||:.|   ...:...:|      ||...
Yeast   705 FLGLWIAILDNSLDIDLIVFIAIFADVAT-----LAIAYDNAPYSPKPVKWNLP------RLWGM 758

  Fly   834 KLILMAYLQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKN-VEDLEDGYGQEW-TYRE 896
            .:||      |::..:..:.|...:....|       ||.:::.:.| :..|:....:.| .:..
Yeast   759 SIIL------GIVLAIGSWITLTTMFLPKG-------GIIQNFGAMNGIMFLQISLTENWLIFIT 810

  Fly   897 RKVLEY--------TAGTGFFVSIVVT 915
            |....:        .||..|.|.|:.|
Yeast   811 RAAGPFWSSIPSWQLAGAVFAVDIIAT 837

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 248/938 (26%)
Cation_ATPase_N 29..102 CDD:214842 21/82 (26%)
E1-E2_ATPase 123..354 CDD:278548 72/248 (29%)
Cation_ATPase 416..509 CDD:289987 25/95 (26%)
COG4087 <673..738 CDD:226572 31/65 (48%)
Cation_ATPase_C 785..994 CDD:279079 28/147 (19%)
PMA1NP_011507.1 Cation_ATPase_N 78..138 CDD:214842 17/64 (27%)
ATPase-IIIA_H 87..842 CDD:273731 237/907 (26%)
E1-E2_ATPase 146..367 CDD:278548 72/248 (29%)
COG4087 551..665 CDD:226572 51/137 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109911940
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S851
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.780

Return to query results.
Submit another query.