DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and ENA1

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_010325.1 Gene:ENA1 SGDID:S000002447 Length:1091 Species:Saccharomyces cerevisiae

Alignment Length:1139 Identity:328/1140 (29%)
Similarity:501/1140 (44%) Gaps:269/1140 (24%)


  Fly    33 HKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNIL------------TPQPPTPKWIVFLKTM 85
            |.:..:|..|.:.|....||:..|...||:..|.|.|            ..|......:|.|.:|
Yeast    18 HTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISM 82

  Fly    86 FGGFAILLW-AGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIVTGLFTYFQVHKSSSIMDS 149
            ...||:..| .|..:.||                    ||:.||:   ||   .|.:|::..|:|
Yeast    83 IISFAMHDWITGGVISFV--------------------IAVNVLI---GL---VQEYKATKTMNS 121

  Fly   150 FKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILEAHGLKVDNSSLTGESEPQ 214
            .|||....|.|||.|:..|:.|.::|.|||..||.||.:|||:|::|......|.|.|||||.|.
Yeast   122 LKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPV 186

  Fly   215 VRSTEFTHENPLETK-----NLAFFSTNVLEGTCRGVVIATGDSTVMGRIANLAAGLD------- 267
            .:..........||.     ||||.|:.|::|..:|:||.|..::.:|:||....|..       
Yeast   187 SKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDP 251

  Fly   268 ----------------------DVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEF-ID- 308
                                  :|.:|:.|::......:...|::     |||.:....:| :| 
Yeast   252 SKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL-----FAIIVMASQKFDVDK 311

  Fly   309 -AVVFLIGIIVANVPEGLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQ 372
             ..::.|.:.::.:|..|:|.:|:.:::.|..|.|:|.:|:.|:::|.||:.:.|||||||||||
Yeast   312 RVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQ 376

  Fly   373 NRMTVAHLWYDQI--IVESDTTESFRG----------------SH-----------FK------- 401
            .:|....:|..:.  |..|::.:.|..                ||           ||       
Yeast   377 GKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKD 441

  Fly   402 ----IEDKSFNALFMCAALCNSAE-FKGGQDD------------IPVF--KKDVNGNA------- 440
                |:...|......|.|.|.|. ||....|            |.||  |.|:..||       
Yeast   442 LPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKST 506

  Fly   441 ------SEAALLKFTETIFAGIGAFRQKHIKLTEIPFNSTEKYQVSVHEFNSSDGYFIVEMKGAP 499
                  .:::|.:..|.    .|:.:.:||  .|.||:||.|...||:..|.::.|.|.. |||.
Yeast   507 NQSNENDQSSLSQHNEK----PGSAQFEHI--AEFPFDSTVKRMSSVYYNNHNETYNIYG-KGAF 564

  Fly   500 ERILDRCSTIIIQGLSVELTPTLKLEFE---EAYLEMGGMGERVLGFADLLLPMSKYPISYEFSA 561
            |.|:..||:...:. .|::||....:.|   :....:...|.||||||           |..|:.
Yeast   565 ESIISCCSSWYGKD-GVKITPLTDCDVETIRKNVYSLSNEGLRVLGFA-----------SKSFTK 617

  Fly   562 DPPN-FPLEN-----------LRFLGLISLIDPPRAAVPDAVAKCRSAGVRVIMVTGDHPITAKA 614
            |..| ..|:|           |.|||||.:.||||.....||.|...||:.|.|:|||...||||
Yeast   618 DQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKA 682

  Fly   615 IARSVGIITTPT---AEDIAKQRGVTVLDIDSRQATAIVVHGGELREMKAEELDAVIYYHNEIVF 676
            ||:.|||:.|..   :::|          :||     :|:.|.:...:..||:|.:...  .:|.
Yeast   683 IAQEVGILPTNLYHYSQEI----------VDS-----MVMTGSQFDGLSEEEVDDLPVL--PLVI 730

  Fly   677 ARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAMGISGSDVSKQAADMILLDDNF 741
            ||.|||.|:.::||..||.:...:|||||||||:||.|::|:||||:||||||:|:|::|.||||
Yeast   731 ARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNF 795

  Fly   742 ASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFVIFD-------IPLALGTIAILCIDIG 799
            |||:..:||||.:.||::|.:...|..|:.:.:..:..::|.       .||:  .:.:|.|.:.
Yeast   796 ASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLS--PVEVLWIIVV 858

  Fly   800 TDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLIL--MAYLQIGVIQTVACFFTFFAIMAEH 862
            |...||:.|..|||..|:|.|.|.|. |..:...::|:  .||   |:|.|.:|..:|...:  :
Yeast   859 TSCFPAMGLGLEKAAPDLMDRPPHDS-EVGIFTWEVIIDTFAY---GIIMTGSCMASFTGSL--Y 917

  Fly   863 GFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGFFVS------IVVTQVFDLL 921
            |....||                 |:..:.||.......|.:.:..|.:      |:..:|.|: 
Yeast   918 GINSGRL-----------------GHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWEVVDM- 964

  Fly   922 ICKTRRN-------------SILQQGMGNHVLNFALVLEFIIACLLCYVPVF-EKTLRMYSIKFI 972
                ||:             ...:...||..|.::::..|:.|..:.|:||. :|......|...
Yeast   965 ----RRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAE 1025

  Fly   973 W-----WIYAFPFGLLIFFFDESRRFLIRR--NP 999
            |     :..||..|..::...:.|.|..:|  ||
Yeast  1026 WGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNP 1059

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 328/1140 (29%)
Cation_ATPase_N 29..102 CDD:214842 21/82 (26%)
E1-E2_ATPase 123..354 CDD:278548 78/268 (29%)
Cation_ATPase 416..509 CDD:289987 36/121 (30%)
COG4087 <673..738 CDD:226572 37/65 (57%)
Cation_ATPase_C 785..994 CDD:279079 54/236 (23%)
ENA1NP_010325.1 ATPase-IID_K-Na 11..1055 CDD:130586 325/1134 (29%)
Cation_ATPase_N 17..85 CDD:279080 16/67 (24%)
E1-E2_ATPase 96..358 CDD:278548 80/293 (27%)
Cation_ATPase 460..574 CDD:289987 36/121 (30%)
COG4087 <700..792 CDD:226572 45/109 (41%)
Cation_ATPase_C 846..1044 CDD:279079 52/228 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.