DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and atp1a1b

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_571765.1 Gene:atp1a1b ZFINID:ZDB-GENE-001212-5 Length:1025 Species:Danio rerio

Alignment Length:1011 Identity:636/1012 (63%)
Similarity:785/1012 (78%) Gaps:11/1012 (1%)


  Fly     4 KKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNI 68
            |||||     .|:|:||:...||:|:.|:||:.::||..:..||.|.||:...|...|..:|||.
Zfish    21 KKKNK-----NKKKEKDMDELKKEVDLDDHKLTLEELNRKYGTDLNRGLTTARAAEILARDGPNA 80

  Fly    69 LTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIVTG 133
            |||.|.||:|:.|.|.|||||::|||.|:.|||:.|.||...:.||.:||||||:.|:.:||:||
Zfish    81 LTPPPTTPEWVKFCKQMFGGFSMLLWTGALLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIITG 145

  Fly   134 LFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILEAH 198
            .|:|:|..|||.|||||||||||.|.|:|:||.|.|.::|:|.||:||||.|||:|||:||:.:|
Zfish   146 CFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKNHVNAEEVVVGDLVEVKGGDRIPADLRIIASH 210

  Fly   199 GLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIANLA 263
            |.||||||||||||||.||.:::::|||||:|:||||||.:|||.||:||:|||.|||||||.||
Zfish   211 GCKVDNSSLTGESEPQTRSPDYSNDNPLETRNIAFFSTNCVEGTARGIVISTGDRTVMGRIATLA 275

  Fly   264 AGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGLLVT 328
            :||:..::|||.||:.||..||..|:.||:|||.:||.|||.:::||:|||||||||||||||.|
Zfish   276 SGLEVGRTPISIEIEHFIHIITGVAVFLGVSFFVLSLALGYSWLEAVIFLIGIIVANVPEGLLAT 340

  Fly   329 VTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESDTTE 393
            |||||||||||||.|||||||||||||||||||||||||||||||||||||:|:|..|.|:||||
Zfish   341 VTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTE 405

  Fly   394 SFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAGIGA 458
            :..|:.|.....::.:|...|.|||.|.|...|.|:|:.|:||.|:|||:||||..|.....:..
Zfish   406 NQSGTSFDRSSATWASLARVAGLCNRAVFLAEQTDVPILKRDVAGDASESALLKCIELCCGSVKD 470

  Fly   459 FRQKHIKLTEIPFNSTEKYQVSVHEFNSSDG---YFIVEMKGAPERILDRCSTIIIQGLSVELTP 520
            .|:|:.|:.|||||||.|||:|||: |.:.|   ..::.|||||||||||||||:|||....|..
Zfish   471 MREKYTKVAEIPFNSTNKYQLSVHK-NPNGGTESKHLLVMKGAPERILDRCSTILIQGKVQALDD 534

  Fly   521 TLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRA 585
            .:|..|:.||||:||:|||||||....||..::|..:.|..:..|||.|||.|:||:|:||||||
Zfish   535 EMKEAFQNAYLELGGLGERVLGFCHFCLPDEEFPEGFPFDTEDVNFPTENLCFVGLMSMIDPPRA 599

  Fly   586 AVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQATA 648
            ||||||.||||||::||||||||||||||||:.||||:  ..|.||||.:..:.|.:::.|.|.|
Zfish   600 AVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNEVNPRDAKA 664

  Fly   649 IVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKR 713
            .|||||:|:::..|:||.::.:|.|||||||||||||||||.|||:|.||||||||||||||||:
Zfish   665 CVVHGGDLKDLSCEQLDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKK 729

  Fly   714 ADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLF 778
            |||||||||:||||||||||||||||||||||.|:||||:||||||||||||||||:|||.|||.
Zfish   730 ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLL 794

  Fly   779 FVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQI 843
            |:|.:|||.|||:.|||||:|||||||||||||.||||||.|.||:|..|:|||::||.:||.||
Zfish   795 FIIANIPLPLGTVTILCIDLGTDMLPAISLAYEAAESDIMKRQPRNPKTDKLVNERLISIAYGQI 859

  Fly   844 GVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGF 908
            |:||.:|.|||:|.|::|:||.||||.|||..||.|::.||||.|||:|||.:||::|:|..|.|
Zfish   860 GMIQALAGFFTYFVILSENGFLPSRLLGIRVYWDDKHINDLEDSYGQQWTYEQRKIVEFTCHTAF 924

  Fly   909 FVSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIW 973
            |.||||.|..||:||||||||:.||||.|.:|.|.|..|..:|..|.|.|..:..||||.:|..|
Zfish   925 FASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPNW 989

  Fly   974 WIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            |..|||:.||||.:||.|:.::|||||||||:||||
Zfish   990 WFCAFPYSLLIFIYDEMRKLILRRNPGGWVERETYY 1025

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 629/997 (63%)
Cation_ATPase_N 29..102 CDD:214842 36/73 (49%)
E1-E2_ATPase 123..354 CDD:278548 158/231 (68%)
Cation_ATPase 416..509 CDD:289987 52/96 (54%)
COG4087 <673..738 CDD:226572 60/65 (92%)
Cation_ATPase_C 785..994 CDD:279079 127/209 (61%)
atp1a1bNP_571765.1 ATPase-IIC_X-K 32..1025 CDD:273445 627/994 (63%)
Cation_ATPase_N 41..115 CDD:214842 36/74 (49%)
E1-E2_ATPase 135..366 CDD:278548 158/231 (68%)
Cation_ATPase 428..523 CDD:289987 52/96 (54%)
COG4087 608..754 CDD:226572 104/146 (71%)
Cation_ATPase_C 801..1010 CDD:279079 127/209 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C368966301
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D50082at33208
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.