DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and SERCA

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_726381.1 Gene:SERCA FlyBaseID:FBgn0263006 Length:1020 Species:Drosophila melanogaster

Alignment Length:1053 Identity:312/1054 (30%)
Similarity:503/1054 (48%) Gaps:143/1054 (14%)


  Fly    31 DNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNILTPQPPTPKWIVFLKTMFGGF--AILL 93
            |.|...|::.|....|||..||:..:.|...:..|||.|..:.....|.:.|: .|...  .|||
  Fly     3 DGHSKTVEQSLNFFGTDPERGLTLDQIKANQKKYGPNELPTEEGKSIWQLVLE-QFDDLLVKILL 66

  Fly    94 WAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIVTGLFTYFQVHKSSSIMDSFKNLVPQYA 158
            .|    ..:.:::.|..:||.........:.:.:::|...:...:|...:.|.:::.|...|:..
  Fly    67 LA----AIISFVLALFEEHEETFTAFVEPLVILLILIANAVVGVWQERNAESAIEALKEYEPEMG 127

  Fly   159 TVIREGE--INTVTSDEIVKGDIVEVKFGDRVPADIRILEAHG--LKVDNSSLTGESEPQVRSTE 219
            .|:|:.:  |..|.:.|||.||:|||..||::||||||...:.  |::|.|.|||||...::.|:
  Fly   128 KVVRQDKSGIQKVRAKEIVPGDLVEVSVGDKIPADIRITHIYSTTLRIDQSILTGESVSVIKHTD 192

  Fly   220 FTHENPL---ETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIANLAAGLDDVQSPISREIQLFI 281
            ...:...   :.||:.|..|||..|..|||||.||.||.:|:|....:..:::::|:.:::..|.
  Fly   193 AIPDPRAVNQDKKNILFSGTNVAAGKARGVVIGTGLSTAIGKIRTEMSETEEIKTPLQQKLDEFG 257

  Fly   282 RFITIFAIILGLSFFAISL------TLGYEFIDAVVF----LIGIIVANVPEGLLVTVTVCLTLT 336
            ..::....::.::.:||::      ..|..:|...::    .:.:.||.:||||...:|.||.|.
  Fly   258 EQLSKVISVICVAVWAINIGHFNDPAHGGSWIKGAIYYFKIAVALAVAAIPEGLPAVITTCLALG 322

  Fly   337 AKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLW-YDQI------IVESDTTES 394
            .:|||.||.:|::|.:|||||.||.||||||||||.|:|:|:.:: :|::      .:|.:.|.|
  Fly   323 TRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFDKVEGNDSSFLEFEMTGS 387

  Fly   395 ---------FRGSHFKIED-KSFNALFMCAALCNSA-----EFKGGQDDIPVFKKDVNGNASEAA 444
                     ..|...|..| .:...|.....:||.:     |||...:.:        |.|:|.|
  Fly   388 TYEPIGEVFLNGQRIKAADYDTLQELSTICIMCNDSAIDYNEFKQAFEKV--------GEATETA 444

  Fly   445 LLKFTETI----------------FAGIGAFRQKHIKLTEIPFNSTEKYQVS------VHEFNSS 487
            |:...|.:                .|..|....|..|...:.|:...|...|      .....:.
  Fly   445 LIVLAEKLNSFSVNKSGLDRRSAAIACRGEIETKWKKEFTLEFSRDRKSMSSYCTPLKASRLGTG 509

  Fly   488 DGYFIVEMKGAPERILDRCSTIIIQGLSVELTPTLKLEFEEAYLEMGGMGE---RVLGFADLLLP 549
            ...|:   |||||.:|:||:...:....|.||..||.:. .|.....|.|.   |.|..|....|
  Fly   510 PKLFV---KGAPEGVLERCTHARVGTTKVPLTSALKAKI-LALTGQYGTGRDTLRCLALAVADSP 570

  Fly   550 MSKYPISYEFSADPPNFPLE-NLRFLGLISLIDPPRAAVPDAVAKCRSAGVRVIMVTGDHPITAK 613
            |.  |...:.......:..| ||.|:|::.::||||..|.|::.:||:||:|||::|||:..||:
  Fly   571 MK--PDEMDLGDSTKFYQYEVNLTFVGVVGMLDPPRKEVFDSIVRCRAAGIRVIVITGDNKATAE 633

  Fly   614 AIARSVGIITTPTAEDIAKQRGVTVLDIDSRQATAIVVHGGELREMKAEELDAVIYYHNEIVFAR 678
            ||.|.:|:.    |||              ...|.....|.|..::...|..|.:  ....:|:|
  Fly   634 AICRRIGVF----AED--------------EDTTGKSYSGREFDDLSPTEQKAAV--ARSRLFSR 678

  Fly   679 TSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAMGISGSDVSKQAADMILLDDNFAS 743
            ..||.|..|||..|...||.|:|||||||:||||:|:||:||| ||:.|:|.||:|:|.||||:|
  Fly   679 VEPQHKSKIVEFLQSMNEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSAAEMVLADDNFSS 742

  Fly   744 IVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFVIFDIPLALGTIAILCIDIGTDMLPAISL 808
            ||..:||||.|::|:|:.|.|.::||:.|:|.........:|.||..:.:|.:::.||.|||.:|
  Fly   743 IVSAVEEGRAIYNNMKQFIRYLISSNIGEVVSIFLTAALGLPEALIPVQLLWVNLVTDGLPATAL 807

  Fly   809 AYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQIG------VIQTVACFFTFFAIMAEHGFPPS 867
            .:...:.|||.:.||.. ::.|::..| ...|:.||      .:...|.:|.|    ::.|...|
  Fly   808 GFNPPDLDIMEKPPRKA-DEGLISGWL-FFRYMAIGFYVGAATVGAAAWWFVF----SDEGPKLS 866

  Fly   868 RLKGIREDWD-SKNVEDLEDGYGQEWTYRERKVLEYTAGTGFFVSIVVT-QVFDLLICKTRRNSI 930
            .       |. :.::..|  |.|.|:...:.|:..........:|::|| ::.:.:...:...|:
  Fly   867 Y-------WQLTHHLSCL--GGGDEFKGVDCKIFSDPHAMTMALSVLVTIEMLNAMNSLSENQSL 922

  Fly   931 LQQG-------MGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIWWIYAFPFGLLIFFFD 988
            :...       :|:..|:|  .|.|:|    .||.|.....::..:....||....|.:.:...|
  Fly   923 ITMPPWCNLWLIGSMALSF--TLHFVI----LYVDVLSTVFQVTPLSAEEWITVMKFSIPVVLLD 981

  Fly   989 ESRRFLIRRNPGG 1001
            |:.:|:.|:...|
  Fly   982 ETLKFVARKIADG 994

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 312/1054 (30%)
Cation_ATPase_N 29..102 CDD:214842 21/73 (29%)
E1-E2_ATPase 123..354 CDD:278548 76/248 (31%)
Cation_ATPase 416..509 CDD:289987 27/120 (23%)
COG4087 <673..738 CDD:226572 37/65 (57%)
Cation_ATPase_C 785..994 CDD:279079 50/224 (22%)
SERCANP_726381.1 Cation_ATPase_N 5..72 CDD:279080 20/72 (28%)
ATPase-IIA1_Ca 53..989 CDD:273452 295/997 (30%)
E1-E2_ATPase 92..340 CDD:278548 76/248 (31%)
Cation_ATPase 419..527 CDD:289987 27/119 (23%)
HAD <604..712 CDD:289480 49/128 (38%)
Cation_ATPase_C 784..987 CDD:279079 50/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111051743
eggNOG 1 0.900 E1_COG0474
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.