DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and ATP1A4

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_653300.2 Gene:ATP1A4 HGNCID:14073 Length:1029 Species:Homo sapiens

Alignment Length:1010 Identity:615/1011 (61%)
Similarity:770/1011 (76%) Gaps:3/1011 (0%)


  Fly     2 PPKKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGP 66
            |.|...|:..:..:::|::::..||:|..|:||:.::||..:...|...|.|...||..|...||
Human    21 PKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGP 85

  Fly    67 NILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIV 131
            |.:||.|.||:|:.|.|.:||||::|||.|:.||||.|.||:....||..|||||.|.|:|:|||
Human    86 NTVTPPPTTPEWVKFCKQLFGGFSLLLWTGAILCFVAYSIQIYFNEEPTKDNLYLSIVLSVVVIV 150

  Fly   132 TGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILE 196
            ||.|:|:|..|||.||:||||:|||.|.|||.||...:...|:|.||:||:|.|||||||:|::.
Human   151 TGCFSYYQEAKSSKIMESFKNMVPQQALVIRGGEKMQINVQEVVLGDLVEIKGGDRVPADLRLIS 215

  Fly   197 AHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIAN 261
            |.|.||||||||||||||.||.:|||||||||:|:.|||||.:|||.||:||||||||||||||:
Human   216 AQGCKVDNSSLTGESEPQSRSPDFTHENPLETRNICFFSTNCVEGTARGIVIATGDSTVMGRIAS 280

  Fly   262 LAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGLL 326
            |.:||...|:||:.||:.||..||:.|:.||::|||:||.|||.:::|::|||||||||||||||
Human   281 LTSGLAVGQTPIAAEIEHFIHLITVVAVFLGVTFFALSLLLGYGWLEAIIFLIGIIVANVPEGLL 345

  Fly   327 VTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESDT 391
            .||||||||||||||.|||||||||||||||||||||||||||||||||||||:|:|..:.|:||
Human   346 ATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDMTVYEADT 410

  Fly   392 TESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAGI 456
            ||...|..|.....::..|...|.|||.|:||..|:.:|:.|:...|:|||:|||||.|..::.:
Human   411 TEEQTGKTFTKSSDTWFMLARIAGLCNRADFKANQEILPIAKRATTGDASESALLKFIEQSYSSV 475

  Fly   457 GAFRQKHIKLTEIPFNSTEKYQVSVHEFNSSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTPT 521
            ...|:|:.|:.|||||||.|||:|:|....|....::.|||||||||:.|||.::.|....:...
Human   476 AEMREKNPKVAEIPFNSTNKYQMSIHLREDSSQTHVLMMKGAPERILEFCSTFLLNGQEYSMNDE 540

  Fly   522 LKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRAA 586
            :|..|:.||||:||:|||||||..|.|| |.:...:.|:.|..|||::||.|:||||:|||||||
Human   541 MKEAFQNAYLELGGLGERVLGFCFLNLP-SSFSKGFPFNTDEINFPMDNLCFVGLISMIDPPRAA 604

  Fly   587 VPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQATAI 649
            |||||:||||||::||||||||||||||||:.||||:  |.|||::|.:..:.:..:|:..|.||
Human   605 VPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETAEEVAARLKIPISKVDASAAKAI 669

  Fly   650 VVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRA 714
            ||||.||:::::::||.::..|.|||||||||||||||||.|||.|.:|||||||||||||||:|
Human   670 VVHGAELKDIQSKQLDQILQNHPEIVFARTSPQQKLIIVEGCQRLGAVVAVTGDGVNDSPALKKA 734

  Fly   715 DIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFF 779
            |||:|||||||||||||||||||||||||||.|:||||:|||||||||.||||||:|||.|||.|
Human   735 DIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIMYTLTSNIPEITPFLMF 799

  Fly   780 VIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQIG 844
            :|..|||.||||.|||||:||||:||||||||.||||||.|:||:|..|.|||.:||.|||.|||
Human   800 IILGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMKRLPRNPKTDNLVNHRLIGMAYGQIG 864

  Fly   845 VIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGFF 909
            :||.:|.|||:|.|:||:||.|..|.|||..|:.|.:.||||.|||:|||.:|||:|:|..|.||
Human   865 MIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFF 929

  Fly   910 VSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIWW 974
            |:|||.|..||:|.||||||:.||||.|.||.|.::.|.::|..|.|.|..:..||||.:|..||
Human   930 VTIVVVQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWW 994

  Fly   975 IYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            :.|.|:.:|||.:||.|:.|||::|.||||:||||
Human   995 LCAIPYSILIFVYDEIRKLLIRQHPDGWVERETYY 1029

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 611/994 (61%)
Cation_ATPase_N 29..102 CDD:214842 33/73 (45%)
E1-E2_ATPase 123..354 CDD:278548 160/231 (69%)
Cation_ATPase 416..509 CDD:289987 47/93 (51%)
COG4087 <673..738 CDD:226572 59/65 (91%)
Cation_ATPase_C 785..994 CDD:279079 124/209 (59%)
ATP1A4NP_653300.2 ATPase-IIC_X-K 35..1029 CDD:273445 611/995 (61%)
Cation_ATPase_N 49..122 CDD:214842 34/73 (47%)
Interaction with phosphoinositide-3 kinase. {ECO:0000250} 90..92 1/2 (50%)
E1-E2_ATPase 154..373 CDD:278548 152/219 (69%)
Cation_ATPase 435..527 CDD:289987 46/92 (50%)
COG4087 609..758 CDD:226572 104/149 (70%)
Cation_ATPase_C 805..1014 CDD:279079 124/209 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.