DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and ATP12A

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_001172014.1 Gene:ATP12A HGNCID:13816 Length:1045 Species:Homo sapiens

Alignment Length:1025 Identity:553/1026 (54%)
Similarity:728/1026 (71%) Gaps:23/1026 (2%)


  Fly     8 KEHKINGKE-------------KKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKL 59
            |..|.:|||             ||...:.|:|::..|:||:...||.|:..||..||||...|..
Human    21 KTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTRAAE 85

  Fly    60 RLEINGPNILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIA 124
            .|..:|||.|||...||:.:.|||.|.|||:||||.|:|||::.|.||..:......:|:|||..
Human    86 LLARDGPNSLTPPKQTPEIVKFLKQMVGGFSILLWVGAFLCWIAYGIQYSSDKSASLNNVYLGCV 150

  Fly   125 LTVLVIVTGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVP 189
            |.::||:||:|.|:|..||::||.||..::||.|.|||:.|..|:.|:::|.|||||||.||::|
Human   151 LGLVVILTGIFAYYQEAKSTNIMSSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIP 215

  Fly   190 ADIRILEAHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLE------GTCRGVVI 248
            ||||:|.:.|.:|||||||||||||.||:||||||||||||:.|:||..||      ||..|:||
Human   216 ADIRVLSSQGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVGTVTGMVI 280

  Fly   249 ATGDSTVMGRIANLAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFL 313
            .|||.|::|.||:||:|:.:.::||:.||:.|:..:...|:.:|:.||.|:::|.|:.:|:::||
Human   281 NTGDRTIIGHIASLASGVGNEKTPIAIEIEHFVHIVAGVAVSIGILFFIIAVSLKYQVLDSIIFL 345

  Fly   314 IGIIVANVPEGLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVA 378
            |||||||||||||.||||.|:|||||||.||||||||||||||||||.|||||||||||||||||
Human   346 IGIIVANVPEGLLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVA 410

  Fly   379 HLWYDQIIVESDTTESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEA 443
            |||:|..|..:||:|......|....:::.:|.....|||.||||.||:::|:.||.|.|:|||.
Human   411 HLWFDNQIFVADTSEDHSNQVFDQSSRTWASLSKIITLCNRAEFKPGQENVPIMKKAVIGDASET 475

  Fly   444 ALLKFTETIFAGIGAFRQKHIKLTEIPFNSTEKYQVSVHEFNSSDG-YFIVEMKGAPERILDRCS 507
            |||||:|.|...:...|:::.|:.|||||||.|:|:|:||.:...| .|::.|||||||||::||
Human   476 ALLKFSEVILGDVMEIRKRNRKVAEIPFNSTNKFQLSIHEMDDPHGKRFLMVMKGAPERILEKCS 540

  Fly   508 TIIIQGLSVELTPTLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLR 572
            ||:|.|....|..:....|..||:|:||:|||||||..|.||..::|.:|.|..|..|||..||.
Human   541 TIMINGEEHPLDKSTAKTFHTAYMELGGLGERVLGFCHLYLPADEFPETYSFDIDAMNFPTSNLC 605

  Fly   573 FLGLISLIDPPRAAVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRG 635
            |:||:|:|||||:.|||||.||||||::||||||||||||||||:|||||:  :.|.||||.:..
Human   606 FVGLLSMIDPPRSTVPDAVTKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANSETVEDIAHRLN 670

  Fly   636 VTVLDIDSRQATAIVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAV 700
            :.|..::.|.|.|.||.|.||::|.:|:||.::..:.|||||||||||||||||.|||:..:|||
Human   671 IAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGCQRQDAVVAV 735

  Fly   701 TGDGVNDSPALKRADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYT 765
            ||||||||||||:||||:||||:|||.:|.||||:||||||||||.|:||||:|||||||:|||:
Human   736 TGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEGRLIFDNLKKTIAYS 800

  Fly   766 LTSNLPEIVPFLFFVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRL 830
            ||.|:.|:.|||.::|..:||.:|||.||.||:|||::|:|:|||||||||||.|.||...:|||
Human   801 LTKNIAELCPFLIYIIVGLPLPIGTITILFIDLGTDIIPSIALAYEKAESDIMNRKPRHKNKDRL 865

  Fly   831 VNKKLILMAYLQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYR 895
            ||:.|.:.:||.||::|.:..|..:|.:.|:.||.|..|..:|.:|:...|.||:|.||||||..
Human   866 VNQPLAVYSYLHIGLMQALGAFLVYFTVYAQEGFLPRTLINLRVEWEKDYVNDLKDSYGQEWTRY 930

  Fly   896 ERKVLEYTAGTGFFVSIVVTQVFDLLICKTRRNSILQQGM-GNHVLNFALVLEFIIACLLCYVPV 959
            :|:.||:|..|.|||.|:|.|:.||:|.|||||||.|||: .|.|:...:..:.||..:|.|...
Human   931 QREYLEWTGYTAFFVGILVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGITSQIIIGLILSYGLG 995

  Fly   960 FEKTLRMYSIKFIWWIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            ....|....::..:|..|.|..:||:.:||.|:..||..||.|.::..||
Human   996 SVTALSFTMLRAQYWFVAVPHAILIWVYDEVRKLFIRLYPGSWWDKNMYY 1045

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 547/1002 (55%)
Cation_ATPase_N 29..102 CDD:214842 37/73 (51%)
E1-E2_ATPase 123..354 CDD:278548 138/237 (58%)
Cation_ATPase 416..509 CDD:289987 52/94 (55%)
COG4087 <673..738 CDD:226572 53/65 (82%)
Cation_ATPase_C 785..994 CDD:279079 97/210 (46%)
ATP12ANP_001172014.1 ATPase-IIC_X-K 42..1045 CDD:273445 547/1003 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.