DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and SPoCk

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_001262220.1 Gene:SPoCk FlyBaseID:FBgn0052451 Length:1062 Species:Drosophila melanogaster

Alignment Length:1041 Identity:313/1042 (30%)
Similarity:487/1042 (47%) Gaps:220/1042 (21%)


  Fly    29 ETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNILTPQPPTPKWIVFLKTMFGGFAILL 93
            |:..|.  ..|:..||:.|...||.:.|||.|.:|.|.|.|......|.|..::: .|....|||
  Fly   110 ESSTHS--ASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIE-QFRNPLILL 171

  Fly    94 WAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIVTGLFTYFQVHKSSSIMDSFKNLVPQYA 158
            ..||.|..|     :..|.   ||.:.:.||:.::|.|    .:.|.::|...::..|.|||...
  Fly   172 LLGSALVSV-----IMKQF---DDAVSITIAILIVVTV----AFIQEYRSEKSLEELKKLVPPEC 224

  Fly   159 TVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILEAHGLKVDNSSLTGESEPQVRSTEF--- 220
            ..:|||.::|..:.|:|.||||.:..|||||||:|:.||..|.:|.||.|||:||..:.|:.   
  Fly   225 HCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLN 289

  Fly   221 -----THENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIANLAAGLDDVQSPISREIQLF 280
                 .|.|   .||:||..|.|..|..:|:|::||:.:..|.:..:....:..::|:.:.:.  
  Fly   290 NTNVKDHSN---MKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMD-- 349

  Fly   281 IRFITIFAIILG--LSFFAISLTLGYEFIDAVVFLIG----------------IIVANVPEGLLV 327
                     |||  |||::. |.:|      |:.|:|                :.||.:||||.:
  Fly   350 ---------ILGAQLSFYSF-LIIG------VIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPI 398

  Fly   328 TVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESD-- 390
            .|||.|.|...|||.:|.:||.|..|||||..:.||||||||||:|.||..      ||:.||  
  Fly   399 VVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTAT------IIITSDGY 457

  Fly   391 ----TTESFRG---------SHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASE 442
                |...:..         ::.::...:...|....|:||:|..:.|         .:.|..:|
  Fly   458 MADVTGAGYNDQGEIHIRHCNNVEMAKTNITNLLEIGAVCNNAYIQNG---------TLLGQPTE 513

  Fly   443 AALLKFTETIFAGIGAFRQKHIKLTEIPFNSTEKYQV--SVHEFNSS--DGYFIVEMKGAPERIL 503
            .||:  ...:..|:.|..:.::::.|.||:|.:|...  .:|::|::  :.:|   .|||.|.:|
  Fly   514 GALV--AVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKEEIFF---AKGALETLL 573

  Fly   504 DRCSTIIIQGLSVELTPTLKLEF-EEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFP 567
            .:|:.......:|.||...:.|| .||| |:|..|.|||..|                   ....
  Fly   574 PQCTKYQFGTQTVPLTKQNEAEFLAEAY-EIGRKGLRVLALA-------------------KGRS 618

  Fly   568 LENLRFLGLISLIDPPRAAVPDAVAKCRSAGVRVIMVTGDHPITAKAI--ARSVGIITT------ 624
            :::|.:.||:.:.||||..|.:::.....:||||.|||||...||.||  :|.:..:.|      
  Fly   619 MQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIDPSRRLQAVPTHAIPAW 683

  Fly   625 PTA-----------------EDIAKQRGVTVLDIDSRQATAIV---------VH-----GGELRE 658
            |||                 |:..|:..:|.|   ::|...:|         :|     |.|:.:
  Fly   684 PTAGGVPLCSASACCSTNCLENAMKEIYLTAL---AQQGLPLVTANLIGIDTIHHQTLSGQEMDQ 745

  Fly   659 MKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAMGIS 723
            |...:||.|.  :|..||.|.||:.||.||::.||.|.||.:|||||||..|||:||||:|||.:
  Fly   746 MNEHQLDKVA--NNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKN 808

  Fly   724 GSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFVIFDIPLAL 788
            |:||.|:||||||::|:|.:|:..||||:.||.|::..:.:.|::::..:.......:.||...|
  Fly   809 GTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPL 873

  Fly   789 GTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQIGVIQTVACFF 853
            ..:.||.|:|..|..||.||..|..:.|::.:.||: .:..::.|.:::...|...:|.      
  Fly   874 NAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRN-VKQPMITKSVVVNVLLSASIIV------ 931

  Fly   854 TFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAG------TGFFVSI 912
                                              .|..|.: :|::.:.|.|      |..|...
  Fly   932 ----------------------------------LGTLWVF-QREMADGTLGKTKRDTTMTFTCF 961

  Fly   913 VVTQVFDLLICKTRRNSILQQGM-GNHVLNFALVLEFIIACLLCYVP----VFE-KTLRMYSIKF 971
            |...:|:.|.|:::..|:...|: .|.:...|:....|...|:.|.|    ||: :.|..|.|.|
  Fly   962 VFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFF 1026

  Fly   972 I 972
            :
  Fly  1027 L 1027

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 313/1042 (30%)
Cation_ATPase_N 29..102 CDD:214842 25/73 (34%)
E1-E2_ATPase 123..354 CDD:278548 85/257 (33%)
Cation_ATPase 416..509 CDD:289987 24/97 (25%)
COG4087 <673..738 CDD:226572 41/65 (63%)
Cation_ATPase_C 785..994 CDD:279079 42/201 (21%)
SPoCkNP_001262220.1 COG4087 <760..823 CDD:226572 41/63 (65%)
Cation_ATPase_C 872..1044 CDD:279079 42/199 (21%)
ATPase-IIA2_Ca 110..1049 CDD:130585 313/1042 (30%)
Cation_ATPase_N 112..179 CDD:279080 24/70 (34%)
E1-E2_ATPase 191..425 CDD:278548 85/259 (33%)
Cation_ATPase 496..579 CDD:289987 24/97 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111209535
eggNOG 1 0.900 E1_COG0474
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.