DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and Atp4a

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_036641.1 Gene:Atp4a RGDID:2177 Length:1034 Species:Rattus norvegicus

Alignment Length:1016 Identity:545/1017 (54%)
Similarity:716/1017 (70%) Gaps:10/1017 (1%)


  Fly     1 MPPKKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEI-- 63
            |..|...|:....|.:||:.:::.||::|.::|::.|.||.::.:|....||   :|.|..|:  
  Rat    22 MAAKMSKKKAGGGGGKKKEKLENMKKEMEMNDHQLSVSELEQKYQTSATKGL---KASLAAELLL 83

  Fly    64 -NGPNILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTV 127
             :|||.|.|...||:::.|.:.:.||...|:|..:.:|.:.:.||........||||||.:||..
  Rat    84 RDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLALALIA 148

  Fly   128 LVIVTGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADI 192
            :|:|||.|.|:|..||::|:.||||||||.|||||:|:...:.:|::|.||:||:|.||||||||
  Rat   149 VVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRVPADI 213

  Fly   193 RILEAHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMG 257
            |||.|.|.||||||||||||||.||.|.|||:||||:|:|||||..||||.:|:|::|||.|::|
  Rat   214 RILSAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTAQGLVVSTGDRTIIG 278

  Fly   258 RIANLAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVP 322
            |||:||:|:::.::||:.||:.|:..|...||:.|.:||.:::.:||.|:.|:||.:.|:||.||
  Rat   279 RIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFVVAMCIGYTFLRAMVFFMAIVVAYVP 343

  Fly   323 EGLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIV 387
            ||||.||||||:|||||:|||||:||||||||||||||.||||||||||||||||:|||:|..|.
  Rat   344 EGLLATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIH 408

  Fly   388 ESDTTESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETI 452
            .:||||...|..|....:::.||.....|||.|.||.|||.:||.|:.|.|:|||.|||||:|..
  Rat   409 TADTTEDQSGQTFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELT 473

  Fly   453 FAGIGAFRQKHIKLTEIPFNSTEKYQVSVHEF-NSSDGYFIVEMKGAPERILDRCSTIIIQGLSV 516
            ......:|.:..|:.|||||||.|:|:|:|.. :..|...::.|||||||:|:|||:|:|:|..:
  Rat   474 LGNAMGYRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQEL 538

  Fly   517 ELTPTLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLID 581
            .|....:..|:.|||.:||:|||||||..|.|....||..|.|..:..|||...|.|.||:|:||
  Rat   539 PLDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYTFDVEAMNFPSSGLCFAGLVSMID 603

  Fly   582 PPRAAVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSR 644
            ||||.|||||.|||:||:|||||||||||||||||.|||||:  :.|.||||.:..:.|..::.:
  Rat   604 PPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRMPVDQVNKK 668

  Fly   645 QATAIVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSP 709
            .|.|.|::|.:|::|...||...:..|.|:|||||||||||:|||:|||.|.|||||||||||||
  Rat   669 DARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSP 733

  Fly   710 ALKRADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIV 774
            |||:|||||||||:|||.:|.|||||||||||||||.|:|:||:||||||||||||||.|:||:.
  Rat   734 ALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELT 798

  Fly   775 PFLFFVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMA 839
            |:|.::...:||.||.|.||.|::.||:.|::||||||||||||...||:|..|||||:.|...:
  Rat   799 PYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESDIMHLRPRNPRRDRLVNEPLAAYS 863

  Fly   840 YLQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTA 904
            |.|||.||:.|.|..:|..||:.|:.|....|:|..|:..:::||:|.||||||:.:|...:||.
  Rat   864 YFQIGAIQSFAGFADYFTAMAQEGWFPLLCVGLRPQWEDHHLQDLQDSYGQEWTFGQRLYQQYTC 928

  Fly   905 GTGFFVSIVVTQVFDLLICKTRRNSILQQG-MGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYS 968
            .|.||:||.:.|:.|:||.||||.|..||| ..|.:|..|:|.:..|.|.|||.|..........
  Rat   929 YTVFFISIEMCQIADVLIRKTRRLSAFQQGFFRNRILVIAIVFQVCIGCFLCYCPGMPNIFNFMP 993

  Fly   969 IKFIWWIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            |:|.||:...|||||||.:||.|:..:|..||.|.:||.||
  Rat   994 IRFQWWLVPMPFGLLIFVYDEIRKLGVRCCPGSWWDQELYY 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 540/999 (54%)
Cation_ATPase_N 29..102 CDD:214842 24/76 (32%)
E1-E2_ATPase 123..354 CDD:278548 142/231 (61%)
Cation_ATPase 416..509 CDD:289987 48/94 (51%)
COG4087 <673..738 CDD:226572 55/65 (85%)
Cation_ATPase_C 785..994 CDD:279079 101/210 (48%)
Atp4aNP_036641.1 H-K_ATPase_N 2..>27 CDD:286172 2/5 (40%)
ATPase-IIC_X-K 42..1034 CDD:273445 538/995 (54%)
Cation_ATPase_N 50..124 CDD:214842 24/77 (31%)
E1-E2_ATPase 145..375 CDD:278548 142/230 (62%)
Cation_ATPase 437..531 CDD:289987 48/94 (51%)
COG4087 <687..>742 CDD:226572 42/55 (76%)
Cation_ATPase_C 809..1018 CDD:279079 101/209 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.