DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and Atp1a3

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:XP_017444264.1 Gene:Atp1a3 RGDID:2169 Length:1026 Species:Rattus norvegicus

Alignment Length:1011 Identity:628/1012 (62%)
Similarity:774/1012 (76%) Gaps:11/1012 (1%)


  Fly     2 PPKKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGP 66
            |.|.|.||        ::|:...||:|....||:.|:|:..:..||...||:..:|:..|..:||
  Rat    24 PKKSKAKE--------RRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGP 80

  Fly    67 NILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIV 131
            |.|||.|.||:|:.|.:.:||||:||||.|:.|||:.|.||..|:.:|..|||||||.|..:||:
  Rat    81 NALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVII 145

  Fly   132 TGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILE 196
            ||.|:|:|..|||.||:||||:|||.|.||||||...|.::|:|.||:||:|.|||||||:||:.
  Rat   146 TGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIIS 210

  Fly   197 AHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIAN 261
            |||.||||||||||||||.||.:.||:|||||:|:.|||||.:|||.||||:||||.|||||||.
  Rat   211 AHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIAT 275

  Fly   262 LAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGLL 326
            ||:||:..::||:.||:.||:.||..|:.||:|||.:||.|||.:::||:|||||||||||||||
  Rat   276 LASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLL 340

  Fly   327 VTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESDT 391
            .||||||||||||||.|||||||||||||||||||||||||||||||||||||:|:|..|.|:||
  Rat   341 ATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADT 405

  Fly   392 TESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAGI 456
            ||...|:.|.....::.||...|.|||.|.||||||:|||.|:||.|:|||:||||..|.....:
  Rat   406 TEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSV 470

  Fly   457 GAFRQKHIKLTEIPFNSTEKYQVSVHEF-NSSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTP 520
            ...|:::.|:.|||||||.|||:|:||. :.:|..:::.||||||||||||:||::||....|..
  Rat   471 KLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDE 535

  Fly   521 TLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRA 585
            .:|..|:.||||:||:|||||||....||..::|..:.|..|..||..:||.|:||:|:||||||
  Rat   536 EMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRA 600

  Fly   586 AVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQATA 648
            ||||||.||||||::||||||||||||||||:.||||:  ..|.||||.:..:.|..::.|.|.|
  Rat   601 AVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA 665

  Fly   649 IVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKR 713
            .|:||.:|::..:|::|.::..|.|||||||||||||||||.|||:|.||||||||||||||||:
  Rat   666 CVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKK 730

  Fly   714 ADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLF 778
            |||||||||:||||||||||||||||||||||.|:||||:||||||||||||||||:|||.|||.
  Rat   731 ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLL 795

  Fly   779 FVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQI 843
            |::.:|||.||||.|||||:||||:||||||||.||||||.|.||:|..|:|||::||.|||.||
  Rat   796 FIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQI 860

  Fly   844 GVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGF 908
            |:||.:..||::|.|:||:||.|..|.|||.:||.:.|.||||.|||:|||.:|||:|:|..|.|
  Rat   861 GMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAF 925

  Fly   909 FVSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIW 973
            ||||||.|..||:||||||||:.||||.|.:|.|.|..|..:|..|.|.|..:..||||.:|..|
  Rat   926 FVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSW 990

  Fly   974 WIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            |..|||:..|||.:||.|:.::|||||||||:||||
  Rat   991 WFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY 1026

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 622/995 (63%)
Cation_ATPase_N 29..102 CDD:214842 33/73 (45%)
E1-E2_ATPase 123..354 CDD:278548 160/231 (69%)
Cation_ATPase 416..509 CDD:289987 54/94 (57%)
COG4087 <673..738 CDD:226572 60/65 (92%)
Cation_ATPase_C 785..994 CDD:279079 126/209 (60%)
Atp1a3XP_017444264.1 ATPase-IIC_X-K 31..1026 CDD:273445 623/1003 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.