DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and Atp1a3

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:XP_011248820.1 Gene:Atp1a3 MGIID:88107 Length:1066 Species:Mus musculus

Alignment Length:1003 Identity:621/1004 (62%)
Similarity:766/1004 (76%) Gaps:11/1004 (1%)


  Fly     2 PPKKKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGP 66
            |.|.|.||        ::|:...||:|....||:.|:|:..:..||...||:..:|:..|..:||
Mouse    24 PKKSKAKE--------RRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGP 80

  Fly    67 NILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVLVIV 131
            |.|||.|.||:|:.|.:.:||||:||||.|:.|||:.|.||..|:.:|..|||||||.|..:||:
Mouse    81 NALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVII 145

  Fly   132 TGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILE 196
            ||.|:|:|..|||.||:||||:|||.|.||||||...|.::|:|.||:||:|.|||||||:||:.
Mouse   146 TGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIIS 210

  Fly   197 AHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIAN 261
            |||.||||||||||||||.||.:.||:|||||:|:.|||||.:|||.||||:||||.|||||||.
Mouse   211 AHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIAT 275

  Fly   262 LAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGLL 326
            ||:||:..::||:.||:.||:.||..|:.||:|||.:||.|||.:::||:|||||||||||||||
Mouse   276 LASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLL 340

  Fly   327 VTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESDT 391
            .||||||||||||||.|||||||||||||||||||||||||||||||||||||:|:|..|.|:||
Mouse   341 ATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADT 405

  Fly   392 TESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAGI 456
            ||...|:.|.....::.||...|.|||.|.||||||:|||.|:||.|:|||:||||..|.....:
Mouse   406 TEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSV 470

  Fly   457 GAFRQKHIKLTEIPFNSTEKYQVSVHEF-NSSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTP 520
            ...|:::.|:.|||||||.|||:|:||. :.:|..:::.||||||||||||:||::||....|..
Mouse   471 KLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDE 535

  Fly   521 TLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRA 585
            .:|..|:.||||:||:|||||||....||..::|..:.|..|..||..:||.|:||:|:||||||
Mouse   536 EMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRA 600

  Fly   586 AVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQATA 648
            ||||||.||||||::||||||||||||||||:.||||:  ..|.||||.:..:.|..::.|.|.|
Mouse   601 AVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA 665

  Fly   649 IVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKR 713
            .|:||.:|::..:|::|.::..|.|||||||||||||||||.|||:|.||||||||||||||||:
Mouse   666 CVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKK 730

  Fly   714 ADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLF 778
            |||||||||:||||||||||||||||||||||.|:||||:||||||||||||||||:|||.|||.
Mouse   731 ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLL 795

  Fly   779 FVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQI 843
            |::.:|||.||||.|||||:||||:||||||||.||||||.|.||:|..|:|||::||.|||.||
Mouse   796 FIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQI 860

  Fly   844 GVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGF 908
            |:||.:..||::|.|:||:||.|..|.|||.:||.:.|.||||.|||:|||.:|||:|:|..|.|
Mouse   861 GMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAF 925

  Fly   909 FVSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIW 973
            ||||||.|..||:||||||||:.||||.|.:|.|.|..|..:|..|.|.|..:..||||.:|..|
Mouse   926 FVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSW 990

  Fly   974 WIYAFPFGLLIFFFDESRRFLIRRNPGG 1001
            |..|||:..|||.:||.|:.::||||||
Mouse   991 WFCAFPYSFLIFVYDEIRKLILRRNPGG 1018

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 616/989 (62%)
Cation_ATPase_N 29..102 CDD:214842 33/73 (45%)
E1-E2_ATPase 123..354 CDD:278548 160/231 (69%)
Cation_ATPase 416..509 CDD:289987 54/94 (57%)
COG4087 <673..738 CDD:226572 60/65 (92%)
Cation_ATPase_C 785..994 CDD:279079 126/209 (60%)
Atp1a3XP_011248820.1 ATPase-IIC_X-K 31..1018 CDD:273445 616/995 (62%)
Cation_ATPase_N 43..117 CDD:214842 33/74 (45%)
E1-E2_ATPase 137..368 CDD:278548 160/231 (69%)
Cation_ATPase 430..524 CDD:289987 54/94 (57%)
COG4087 609..755 CDD:226572 101/146 (69%)
Cation_ATPase_C 802..1011 CDD:279079 126/209 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.