DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and Atp12a

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_619593.2 Gene:Atp12a MGIID:1926943 Length:1035 Species:Mus musculus

Alignment Length:1015 Identity:549/1016 (54%)
Similarity:732/1016 (72%) Gaps:11/1016 (1%)


  Fly     4 KKKNKEHKINGKEK-----KKDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEI 63
            :|.:|:.| .||.|     |...:..||:::.|:|::...:|.::..|:...|||.:.|...|..
Mouse    23 QKDDKKFK-GGKNKDSEPNKSQEEELKKELDLDDHRLSNTDLEQKYGTNIIQGLSSIRAAELLAR 86

  Fly    64 NGPNILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPDDNLYLGIALTVL 128
            :|||.|||...||:.|.|||.|.|||:||||.|:.||::.|:|| ........||:|||..|.::
Mouse    87 DGPNALTPPKQTPEIIKFLKQMVGGFSILLWIGAALCWIAYVIQ-YVSSTASLDNVYLGAILVLV 150

  Fly   129 VIVTGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIR 193
            ||:||:|.|:|..||::||.||..::||.|.|||:.|...:.::::|.||:||:|.||::|||||
Mouse   151 VILTGIFAYYQEAKSTNIMASFSKMIPQQALVIRDAEKKIIPAEQLVVGDVVEIKGGDQIPADIR 215

  Fly   194 ILEAHGLKVDNSSLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGR 258
            ::.:.|.||||||||||||||.|||||||||||||||:.|:||..||||..|:||.|||.|::||
Mouse   216 LVFSQGCKVDNSSLTGESEPQARSTEFTHENPLETKNIGFYSTTCLEGTATGIVINTGDRTIIGR 280

  Fly   259 IANLAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPE 323
            ||:||:|:...::||:.||:.|:..:...|:.:|:.||..::.:.|..:||::|||.||||||||
Mouse   281 IASLASGVGSEKTPIAIEIEHFVHIVAAVAVSVGVIFFITAVCMKYYVLDAIIFLISIIVANVPE 345

  Fly   324 GLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVE 388
            |||.||||.|:|||||||.||||||||||||||||||.||||||||||||||||||||:|..|..
Mouse   346 GLLATVTVTLSLTAKRMAKKNCLVKNLEAVETLGSTSIICSDKTGTLTQNRMTVAHLWFDNQIFV 410

  Fly   389 SDTTESFRGSHFKIEDKSFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIF 453
            :||:|:.....|.....::.:|.....|||.|||:.||:.:|:.|:.|.|:|||.|||||:|.|.
Mouse   411 ADTSENQTKQAFDQSSGTWASLSKIITLCNRAEFRPGQESVPIMKRVVVGDASETALLKFSEVIL 475

  Fly   454 AGIGAFRQKHIKLTEIPFNSTEKYQVSVHEF-NSSDGYFIVEMKGAPERILDRCSTIIIQGLSVE 517
            ..:...|:::.|:.|||||||.|:|:|:||. :.:|..|::.|||||||||::||||:|.|....
Mouse   476 GDVMDIRKRNHKVAEIPFNSTNKFQLSIHETEDPNDKRFLMVMKGAPERILEKCSTIMINGQEQP 540

  Fly   518 LTPTLKLEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDP 582
            |..:....|..||:|:||:|||||||..|.||..|:|.||.|..|..|||..||.|:||:|:|||
Mouse   541 LDKSSADAFHTAYMELGGLGERVLGFCHLYLPADKFPQSYTFDVDSINFPTSNLCFVGLLSMIDP 605

  Fly   583 PRAAVPDAVAKCRSAGVRVIMVTGDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQ 645
            ||:.|||||:||||||::||||||||||||||||:|||||:  ..|.|||||:|.:.|..::.|:
Mouse   606 PRSTVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKSVGIISANNETVEDIAKRRNIAVEQVNKRE 670

  Fly   646 ATAIVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPA 710
            |.|.||.|.||::|..|:||.::..:.|||||||||||||||||.|||:..:|||||||||||||
Mouse   671 AKAAVVTGMELKDMTPEQLDELLINYQEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPA 735

  Fly   711 LKRADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVP 775
            ||:||||:||||:|||.:|.||||:||||||||||.|:||||:|||||||:||||||.|:.|:.|
Mouse   736 LKKADIGIAMGIAGSDAAKNAADMVLLDDNFASIVTGVEEGRLIFDNLKKTIAYTLTKNIAELCP 800

  Fly   776 FLFFVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAY 840
            ||.:::..:||.:|||.||.||:|||::|:|:|||||||||||.|.||...:||||||:|.:.:|
Mouse   801 FLIYIVAGLPLPIGTITILFIDLGTDIIPSIALAYEKAESDIMNRKPRHKKKDRLVNKQLAIYSY 865

  Fly   841 LQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAG 905
            |.||::|.:..|..:|.:.|:.||.|:.|..:|..|::.::.||||.||||||..:||.||:|..
Mouse   866 LHIGLMQALGGFLVYFTVYAQQGFWPTSLINLRVSWETDDINDLEDSYGQEWTRYQRKYLEWTGS 930

  Fly   906 TGFFVSIVVTQVFDLLICKTRRNSILQQGM-GNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSI 969
            |.|||:|:|.|:.||:|.|||||||.|||: .|.|:...::.:.|:|.:|.|.......|....:
Mouse   931 TAFFVAIMVQQIADLIIRKTRRNSIFQQGLFRNKVIWVGIISQIIVALVLSYGLGSVTALSFTML 995

  Fly   970 KFIWWIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            :..:|..|.|..:||:.:||.|:..||..||.|.::..||
Mouse   996 RAQYWFVAVPHAILIWVYDEMRKLFIRLYPGSWWDKNMYY 1035

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 543/1001 (54%)
Cation_ATPase_N 29..102 CDD:214842 32/73 (44%)
E1-E2_ATPase 123..354 CDD:278548 134/231 (58%)
Cation_ATPase 416..509 CDD:289987 50/94 (53%)
COG4087 <673..738 CDD:226572 53/65 (82%)
Cation_ATPase_C 785..994 CDD:279079 99/210 (47%)
Atp12aNP_619593.2 ATPase-IIC_X-K 40..1035 CDD:273445 542/996 (54%)
Cation_ATPase_N 52..123 CDD:214842 31/71 (44%)
E1-E2_ATPase 145..376 CDD:278548 134/231 (58%)
Cation_ATPase 438..532 CDD:289987 50/94 (53%)
HAD <612..737 CDD:289480 84/125 (67%)
Cation_ATPase_C 810..1020 CDD:279079 99/210 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.