DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and catp-2

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_504328.1 Gene:catp-2 WormBaseID:WBGene00015338 Length:1050 Species:Caenorhabditis elegans

Alignment Length:1058 Identity:378/1059 (36%)
Similarity:581/1059 (55%) Gaps:92/1059 (9%)


  Fly     5 KKNKEHKINGKEKKKDIQSFKKDVETDNHKIPVDELLERLK------TDPNM--GLSFVEAKLRL 61
            ::..|...:..:..|::......:..:.|.:.:.:|.|:..      .||.:  |||...|..||
 Worm    12 RRGDEASDSKADASKEVNQQNLSLSFNEHHLDMRQLSEKFSMSKLDIVDPKVSRGLSKQVAAERL 76

  Fly    62 EINGPNILTPQPPTPKWIVFLKTMFGGFAILLWAGSFLCFVGYLIQLQTQHEPPD-DNLYLGIAL 125
            |.:|.|.|:|......|.:||:.......||::..:.|..|.|:      ::|.| .||.:||.:
 Worm    77 ESDGRNALSPPKVISNWKLFLRQFKNLLWILMFGAAALSLVAYI------YDPSDLTNLCVGIFI 135

  Fly   126 TVLVIVTGLFTYFQVHKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPA 190
            .|::.|..:.::|:..|...::.:|::|:|....|||:|...|:..:|:|.||||.|:.|.:|||
 Worm   136 IVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTLNPEELVVGDIVVVRSGCKVPA 200

  Fly   191 DIRILEAHGLKVDNSSLTGESEPQVRSTEFTHENP--LETKNLAFFSTNVLEGTCRGVVIATGDS 253
            |||::......::.||:|||:||...::....:..  .|:.|:||..:..::|...|:||.||:.
 Worm   201 DIRVIACTDFYLETSSITGEAEPLEFNSAMADQKTSIFESYNIAFNGSFCVDGEGYGIVIRTGER 265

  Fly   254 TVMGRIANLAAGLDDVQSPISREIQLFIRFITIFAIILGLSFFAISLTL--GYEFIDAVV--FLI 314
            ||:|:||::.....:.:.....||..|::|||:.|||:.:..|::.|.:  |::.|...|  ||:
 Worm   266 TVIGQIASMTLDQKEQKCKFQVEIGRFVKFITVMAIIMAVIIFSVGLGINKGHDVIRYFVTGFLM 330

  Fly   315 GIIVANVPEGLLVTVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAH 379
             :|:||||:||..|||..||:.|:|||.||..:|.||.::::|:|:.|.||||||||:|.|||..
 Worm   331 -VIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTD 394

  Fly   380 LWYDQIIVESDTTESFRGS---HFKIED---KSFNA----LFMCAALCNSAEFKG---------- 424
            |||:. ...|...|:.|.|   .|.|..   :||:|    |.....:||.|..:.          
 Worm   395 LWYNN-SYNSGRPENRRRSTKTRFSITSNPAQSFDAPLSDLLSVVCVCNKARIENTVTVNRPPPN 458

  Fly   425 --GQDDI------PVFKKDVNGNASEAALLKFTETIFAGIGAFRQKHIKLTEIPFNSTEKYQV-- 479
              .:.|:      ||.:..:.||.||.|||::...:. .....|:....:.||||||..||.:  
 Worm   459 VDSELDMSMYRIQPVKEMTIVGNPSEVALLRYASAML-DAKELRESFQVVFEIPFNSVRKYHLIL 522

  Fly   480 --SVHEFN----SSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTPTLKLEFEEAYLEMGGMGE 538
              :.:.:|    :.|..|:|.:|||||.::..|||:.|.|.|.||......:|.|||...|..|.
 Worm   523 ATNKNTWNQVDKNDDVEFVVMIKGAPEVLIKNCSTMNINGESKELDLKRMEDFNEAYEAFGDEGC 587

  Fly   539 RVLGFADLLLPMSKY--PISYEFSADPPNFPLENLRFLGLISLIDPPRAAVPDAVAKCRSAGVRV 601
            ||:|||     ..|:  ..|..||......|:|:..|||:.:::||||...|.|:..|::||::|
 Worm   588 RVIGFA-----QKKFRARASTVFSLKSNTVPMEDWDFLGMSAIMDPPRDDTPKAIKACKAAGIKV 647

  Fly   602 IMVTGDHPITAKAIARSVGIITTPTAEDIAK-QRGVTVLDIDSRQATAIVVHGGELREMKAEELD 665
            .||||||..||.||||.:|:|.|   |:::: .....::...:.|..|::. |.||..:..::.|
 Worm   648 YMVTGDHKSTATAIARQIGMIDT---EEVSRVDHNQQIIRRSNSQDWAVIT-GSELPALTQKQWD 708

  Fly   666 AVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAMGISGSDVSKQ 730
            .:: .|..||||||:|:.||:||...|:|||.|.||||||||:||||:||:|||||::||||:||
 Worm   709 ELL-QHRYIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQ 772

  Fly   731 AADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFVIFDIPLALGTIAILC 795
            |||:|||||||:|||.||||||::||||:|:||||:....||:||.:....|..||.|..:.||.
 Worm   773 AADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMAHMWPELVPVILNFFFGFPLGLTPVQILS 837

  Fly   796 IDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQIGVIQTVACFFTFFAIMA 860
            ||:.:|:.||:|||||..|:|||.:.||.. :..||.|.||...||.:.:..::.|...:.....
 Worm   838 IDLISDIPPAVSLAYEGPEADIMLQPPRKK-DTHLVTKGLITYTYLFMSIFISIGCVCAYLLSYY 901

  Fly   861 EHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGFFVSIVVTQVFDLLICKT 925
            .:|..|..|......:......:.....|......::..:...|...|.:|:|:.|.|.|.:|.|
 Worm   902 INGIGPWELAFTASTYFKHGAANFTTAKGVILNEEQQMYMANQAAAAFHISLVLGQAFHLWMCLT 966

  Fly   926 RRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFI-------W--WIYAFPFG 981
            ||.||...|:||.|..||::::.::.|:..:||         .:|:|       |  |:.....|
 Worm   967 RRVSIFAHGLGNIVAIFAVIIDLLLICIFTFVP---------GVKYIFGSQPPPWQCWLVPIVVG 1022

  Fly   982 LLIFFFDESRRFLIRRNP 999
            :.|:.|:|.|:..||:.|
 Worm  1023 VWIWIFNELRKLGIRKYP 1040

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 377/1047 (36%)
Cation_ATPase_N 29..102 CDD:214842 22/81 (27%)
E1-E2_ATPase 123..354 CDD:278548 86/237 (36%)
Cation_ATPase 416..509 CDD:289987 34/119 (29%)
COG4087 <673..738 CDD:226572 47/65 (72%)
Cation_ATPase_C 785..994 CDD:279079 64/218 (29%)
catp-2NP_504328.1 ATPase-IIC_X-K 35..1040 CDD:273445 375/1034 (36%)
Cation_ATPase_N 36..118 CDD:214842 23/82 (28%)
E1-E2_ATPase 144..369 CDD:278548 83/226 (37%)
Cation_ATPase 440..558 CDD:289987 34/119 (29%)
COG4087 <715..780 CDD:226572 47/65 (72%)
Cation_ATPase_C 827..1034 CDD:279079 64/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104946687
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.