DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and catp-4

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:NP_497034.2 Gene:catp-4 WormBaseID:WBGene00007248 Length:1015 Species:Caenorhabditis elegans

Alignment Length:1022 Identity:517/1023 (51%)
Similarity:682/1023 (67%) Gaps:39/1023 (4%)


  Fly    15 KEKK--KDIQSFKKDVETDNHKIPVDELLERLKTDPNMGLSFVEAKLRLEINGPNILTPQPPTPK 77
            |:||  |.::..||||..|:|:||:|.|.:|..|....|:|..||..||..:|||.|||...|.|
 Worm     6 KKKKTNKSLEDLKKDVVIDDHEIPLDALFKRYTTSEKNGISEAEATNRLNRDGPNALTPPKQTSK 70

  Fly    78 WIVFLKTMFGGFAILLWAGSFLCFVGYLIQL--QTQHEPPDDNLYLGIALTVLVIVTGLFTYFQV 140
            ||....::||||..|||..:....|||.:.|  ....|.|.||:|:.|.|..:|.|||||.::|.
 Worm    71 WIKLAGSIFGGFNFLLWCAASASAVGYGMDLSMSDDEEVPKDNMYMAIILATVVTVTGLFDFYQN 135

  Fly   141 HKSSSIMDSFKNLVPQYATVIREGEINTVTSDEIVKGDIVEVKFGDRVPADIRILEAHGLKVDNS 205
            .||.::||||.|::|....|:|:|....:...::|.||:|..:.|||||||:|:..|.|||||||
 Worm   136 RKSGNLMDSFANMIPPKTLVVRDGATREIEVKDLVVGDLVRFRGGDRVPADLRVTLARGLKVDNS 200

  Fly   206 SLTGESEPQVRSTEFTHENPLETKNLAFFSTNVLEGTCRGVVIATGDSTVMGRIANLAAGLDDVQ 270
            |||||||||.|:...|.:|.||||||..|||:||||:..|::|.|||.|.:||||.|...:|...
 Worm   201 SLTGESEPQTRNMNCTSKNALETKNLCMFSTSVLEGSGEGIIIGTGDRTFVGRIAALTTQVDPGP 265

  Fly   271 SPISREIQLFIRFITIFAIILGLSFFAISLTLGYEFIDAVVFLIGIIVANVPEGLLVTVTVCLTL 335
            :|:::||..||:.|:|.|..:|::||.::|...|..:.|:||.:||:|||||||::.||||.|||
 Worm   266 TPLAKEINHFIKIISIVAFTVGIAFFILALVYEYPPLKAIVFFMGIVVANVPEGIVPTVTVSLTL 330

  Fly   336 TAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDQIIVESDTTESFRGSHF 400
            ||.:|..|.||||.|:||||||||||||||||||||||||||.|||:|..|  .||.......||
 Worm   331 TAVKMRKKFCLVKKLQAVETLGSTSTICSDKTGTLTQNRMTVTHLWFDGKI--KDTEILPPNDHF 393

  Fly   401 KIEDK-----SFNALFMCAALCNSAEFKGGQDDIPVFKKDVNGNASEAALLKFTETIFAG--IGA 458
            |.|.|     |:..|..||.||:.:.|:..:.|:|:.|:.|||:|||.|::::.|.|...  :..
 Worm   394 KGEKKYEKEDSYQKLLRCATLCSRSHFRVPEFDVPLAKRVVNGDASEVAIMRYCEMIRGDGQVDE 458

  Fly   459 FRQKHIKLTEIPFNSTEKYQVSVHEFNSSDGYFIVEMKGAPERILDRCSTIIIQGLSVELTPTLK 523
            ||:...|:.|||||||.|||:|:|..:....  |:.||||||:||..|||....|.:..::...:
 Worm   459 FRKIMPKIGEIPFNSTNKYQLSIHPMSKKQN--ILVMKGAPEKILKLCSTYYQNGETKNVSKKFE 521

  Fly   524 LEFEEAYLEMGGMGERVLGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRAAVP 588
            .||::||..:|..|||||||.||.:..:|:|..::|:.:.||||::|||||||||:|||||..||
 Worm   522 KEFQQAYETLGSYGERVLGFCDLEMSTTKFPPGFKFNMEEPNFPIKNLRFLGLISMIDPPRPGVP 586

  Fly   589 DAVAKCRSAGVRVIMVTGDHPITAKAIARSVGII---------------TTPTAEDI-AKQRGVT 637
            :||..|::||:||:||||||||||:|||..|.||               ..|.:::| .|.|   
 Worm   587 EAVRVCQNAGIRVVMVTGDHPITARAIANQVHIIEENVQVTEIVNADPKCDPASDEIYGKGR--- 648

  Fly   638 VLDIDSRQATAIVVHGGELREMKAEELDAVIYYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTG 702
                 .:...|:|:||.:|..|..:.|.||:..:::||||||||.|||.||||.|..|.||.|||
 Worm   649 -----LKPTGAVVIHGEQLTTMSPKTLKAVVTNYHQIVFARTSPAQKLQIVEAFQSVGNIVGVTG 708

  Fly   703 DGVNDSPALKRADIGVAMGISGSDVSKQAADMILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLT 767
            |||||:|||::||||:||||:|:||||||||||||:|||||||.|:||||:||||||||||||||
 Worm   709 DGVNDAPALRKADIGIAMGITGTDVSKQAADMILLNDNFASIVTGVEEGRLIFDNLKKSIAYTLT 773

  Fly   768 SNLPEIVPFLFFVIFDIPLALGTIAILCIDIGTDMLPAISLAYEKAESDIMARMPRDPFEDRLVN 832
            ||:|||.||:.:|:|.:||.:..||||.||:|||:.||||.|||..|||||.|.||:|..|:|||
 Worm   774 SNIPEITPFMSYVLFGLPLPMSIIAILMIDLGTDLWPAISFAYEVPESDIMQRAPRNPLYDKLVN 838

  Fly   833 KKLILMAYLQIGVIQTVACFFTFFAIMAEHGFPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRER 897
            |:|::.:|:|||.||..|.|.|:|.:|..:|:.|..|..|.|.||:|.::||||.|||:|:|..|
 Worm   839 KRLVMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYESR 903

  Fly   898 KVLEYTAGTGFFVSIVVTQVFDLLICKTRRNSILQQGMGNHVLNFALVLEFIIACLLCYVPVFEK 962
            |.||......||.:|||||..||...|||:||::.|||.|||||.:::....:|..:...|...:
 Worm   904 KALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVLNTPFVNE 968

  Fly   963 TLRMYSIKFIWWIYAFPFGLLIFFFDESRRFLIRRNPGGWVEQETYY 1009
            .|.:...:......|.||...|..:||.||:.||..|||::.:||||
 Worm   969 VLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYPGGYIYKETYY 1015

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 515/1019 (51%)
Cation_ATPase_N 29..102 CDD:214842 31/73 (42%)
E1-E2_ATPase 123..354 CDD:278548 120/231 (52%)
Cation_ATPase 416..509 CDD:289987 42/95 (44%)
COG4087 <673..738 CDD:226572 51/65 (78%)
Cation_ATPase_C 785..994 CDD:279079 98/209 (47%)
catp-4NP_497034.2 ATPase-IIC_X-K 9..1015 CDD:273445 514/1018 (50%)
Cation_ATPase_N 24..95 CDD:214842 31/71 (44%)
E1-E2_ATPase 118..349 CDD:278548 120/231 (52%)
Cation_ATPase 414..507 CDD:289987 42/95 (44%)
HAD <582..718 CDD:289480 69/144 (48%)
Cation_ATPase_C 791..1000 CDD:279079 98/209 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 1 1.000 FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43294
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.