DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JYalpha and atp4a

Sequence 1:NP_001104092.2 Gene:JYalpha FlyBaseID:FBgn0267363 Length:1009 Species:Drosophila melanogaster
Sequence 2:XP_002942857.2 Gene:atp4a XenbaseID:XB-GENE-486104 Length:472 Species:Xenopus tropicalis

Alignment Length:472 Identity:265/473 (56%)
Similarity:344/473 (73%) Gaps:3/473 (1%)


  Fly   541 LGFADLLLPMSKYPISYEFSADPPNFPLENLRFLGLISLIDPPRAAVPDAVAKCRSAGVRVIMVT 605
            |||..|.|...:||..:.|..:..|||...|.|.||||:||||||.|||||.|||:||:||||||
 Frog     1 LGFCHLYLNEKEYPRGFSFDTEEMNFPTSGLCFAGLISMIDPPRATVPDAVMKCRTAGIRVIMVT 65

  Fly   606 GDHPITAKAIARSVGIIT--TPTAEDIAKQRGVTVLDIDSRQATAIVVHGGELREMKAEELDAVI 668
            |||||||||||.|||||:  :.|.||||.:..:.|..::.|.|.|.|::||:|::|.:|||...:
 Frog    66 GDHPITAKAIAASVGIISEGSETVEDIAARLRIPVEQVNKRDARACVINGGQLKDMTSEELVEAL 130

  Fly   669 YYHNEIVFARTSPQQKLIIVEACQRRGEIVAVTGDGVNDSPALKRADIGVAMGISGSDVSKQAAD 733
            ..|.|:|||||||||||||||:||:.|.||||||||||||||||:|||||||||:|||.:|.|||
 Frog   131 KLHPEMVFARTSPQQKLIIVESCQKLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAAD 195

  Fly   734 MILLDDNFASIVVGIEEGRIIFDNLKKSIAYTLTSNLPEIVPFLFFVIFDIPLALGTIAILCIDI 798
            ||||||||||||.|:|:||:||||||||||||||.|:||:.|:|.::...:||.||.|.||.|::
 Frog   196 MILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELAPYLIYITASVPLPLGCITILFIEL 260

  Fly   799 GTDMLPAISLAYEKAESDIMARMPRDPFEDRLVNKKLILMAYLQIGVIQTVACFFTFFAIMAEHG 863
            .||:.|::|||||:||||||...||:|..|||||:.|.:.:|.|:|:||:.|.|..:|.:||:.|
 Frog   261 CTDIFPSVSLAYERAESDIMHLKPRNPRRDRLVNEALAVYSYFQVGIIQSFAGFVDYFTVMAQEG 325

  Fly   864 FPPSRLKGIREDWDSKNVEDLEDGYGQEWTYRERKVLEYTAGTGFFVSIVVTQVFDLLICKTRRN 928
            :.|:.:.|:|..|::::::||||.|||:||:.:|...:|...|.||:||.|.|:.|:||.||||.
 Frog   326 WFPAYVLGLRSHWENQHLQDLEDSYGQQWTFSQRLYQQYNCYTVFFISIEVCQIADVLIRKTRRL 390

  Fly   929 SILQQG-MGNHVLNFALVLEFIIACLLCYVPVFEKTLRMYSIKFIWWIYAFPFGLLIFFFDESRR 992
            |:.||| ..|.||..|:|.:..:...|||.|..........|:|.||:...|||:|||.:||.|:
 Frog   391 SVFQQGFFRNKVLVIAIVFQLCLGNFLCYCPGMPNVFNFMPIRFQWWLVPVPFGILIFVYDEIRK 455

  Fly   993 FLIRRNPGGWVEQETYY 1009
            ..:|||||.|.::|.||
 Frog   456 LGVRRNPGSWYDKELYY 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JYalphaNP_001104092.2 ATPase-IIC_X-K 17..1009 CDD:273445 264/471 (56%)
Cation_ATPase_N 29..102 CDD:214842
E1-E2_ATPase 123..354 CDD:278548
Cation_ATPase 416..509 CDD:289987
COG4087 <673..738 CDD:226572 55/65 (85%)
Cation_ATPase_C 785..994 CDD:279079 97/210 (46%)
atp4aXP_002942857.2 COG4087 54..>180 CDD:226572 83/126 (66%)
Cation_ATPase_C 247..456 CDD:279079 97/209 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D388324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.