DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34425 and Cfap53

Sequence 1:NP_001097683.1 Gene:CG34425 FlyBaseID:FBgn0085454 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_083224.2 Gene:Cfap53 MGIID:1921703 Length:514 Species:Mus musculus

Alignment Length:477 Identity:115/478 (24%)
Similarity:212/478 (44%) Gaps:54/478 (11%)


  Fly    12 NFITRTDRKSLHTQIGLLVNKAKEVTAAELHERSKRLKNMLDEEDKRYEEEF---SNTVKNRIDQ 73
            ::|.|.:.|:..:.:...|..|.:.......||..:|:.:|..|:..|..|.   ..|::.:.|:
Mouse    65 DWIQRNNHKTFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDK 129

  Fly    74 DIKERKEHLHAIKEQVAKQQKKFLEEKHIQQVMLDCYEIREALRHQDLVETKIVQEE--QILENQ 136
             ::||.:.|...||   |::::|:.||..||....|.|:|..|  ..:.|.|:|:|.  ||..|:
Mouse   130 -MRERTKLLREKKE---KERQEFVAEKLDQQFRERCEELRTKL--ASIHEKKVVEERNAQIEFNK 188

  Fly   137 RKKRRECQQDNYWLELNRRRWAQFDCNQAEENQRRHQMQQQVNHVLAVQVAEHEEKRKAALAERM 201
            ..||::..:::.:..|........:..:|:|.:|:.::.|.....|..||...:.:|:.|...:.
Mouse   189 ELKRQKLVEEHLFARLWEEDRLAKERREAQEEKRQRELVQNTRLGLDAQVTSIQAQRQGARRMKE 253

  Fly   202 EDERLINSLLEEIRLEEFEKEHQAAPVDQLAYQDELLKEIERKRCARLAEWEAE-KANHVAFCRE 265
            |:.|::.....:|:.|: |:|.......:...:..|.|.::.|..:...|:..: ..|.....|.
Mouse   254 EEARILEQNKAQIKRED-EQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRA 317

  Fly   266 TQRLEAEALANIAQSKKDLNRATLEYLAYLRRMQSLELGIEKMMDERIADLYQLDMCTKVNITER 330
            .|.|:.|| ....|.::::.|....|..||.:.:..|...||.::..:.|:....:..|    :|
Mouse   318 LQDLQDEA-DKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLLEDIKAKKLAEK----DR 377

  Fly   331 VRVKREAAEK--CHEIL--RK-QICEDYERKIRSDAE--LRENKMMEN-RFVHPEVTHEMI-AC- 385
            ....:.||.|  .:|::  || |:.|..:||:|...|  |.|.::.|: :.:|.|...:.. .| 
Mouse   378 ELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCA 442

  Fly   386 ------RQIQHKADLDAQIKEMKRIQEEEEKRFDSRLMA--AVDDPVLCKRLAKE--ILDNGVDY 440
                  .|:|.:.....|.:|.::  |||.:.|::.|.|  |..|.:  :|:..|  .|...|  
Mouse   443 LAEEYRNQLQMQIAHQQQAREAEK--EEERQEFEAGLAANKACLDKI--QRILSENQALSQNV-- 501

  Fly   441 LAPHPNWRVMACNPNKYIPRPP 462
               ||..|       .|..:||
Mouse   502 ---HPMRR-------GYPDKPP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34425NP_001097683.1 PTZ00121 <29..402 CDD:173412 94/395 (24%)
Cfap53NP_083224.2 TPH 161..490 CDD:290579 81/341 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31183
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.