DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34425 and cfap53

Sequence 1:NP_001097683.1 Gene:CG34425 FlyBaseID:FBgn0085454 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001038595.2 Gene:cfap53 ZFINID:ZDB-GENE-060503-508 Length:519 Species:Danio rerio

Alignment Length:436 Identity:107/437 (24%)
Similarity:185/437 (42%) Gaps:124/437 (28%)


  Fly    32 KAKEVTA----AELHERSKRLKNMLDEEDKRYEEEFSNTVKNRIDQDIKERKEHLHAIKEQVAKQ 92
            :||:.|.    |::||.:|.|:       :|.|.|....|.:::||..:|:.|.|.|:  |:.::
Zfish   117 EAKKETVLERQAKMHEGAKTLR-------ERRESERQRVVADKLDQLFREQSEELRAV--QIKRR 172

  Fly    93 QKKFLEEKHIQQVMLDCYEIREALRHQDLVETKIVQEEQILENQRKKRRECQQDNYWLELNRRRW 157
            |         .||   |.|....:|.::.|.....:||::.....:..|..:::.:.|||.|   
Zfish   173 Q---------DQV---CTERESQIRTKEEVRRVQEEEEKLFAQMWESDRLAKEERHNLELQR--- 222

  Fly   158 AQFDCNQAEENQRRHQMQQQVNHVLAVQVAEHEEKRKAALAERMEDERLINSLLEEIRLEEFEKE 222
                       ||.:.:||:.  ||..|:...|::|..|...:.|:.:|:....|.:|||. |:|
Zfish   223 -----------QRENNLQQKA--VLQTQMDMAEQQRIQAKELKQEEAQLLKDQREMLRLEA-ERE 273

  Fly   223 HQAAPVDQ------------------------------------LAY-----QDELLKEIER-KR 245
            |:....||                                    ||.     |||:||::|| :.
Zfish   274 HRQKLQDQEKRRKQLDLSLRLKMKRLTRDRQEELALDMSILEQLLAQEKDEKQDEVLKKLERQEE 338

  Fly   246 CARLAEWEAEKANHVAFCRETQRLEAEALANIAQSKKDLNRATLEYLAYLRRMQSLELGIEKMMD 310
            ..|..|:..::      ..|.:|||||.        :.|..:.|:. |:.||  ..:..:||...
Zfish   339 QRRYREYLTQQ------LEEQKRLEAET--------EQLFESELQQ-AWARR--EAQWRLEKTAR 386

  Fly   311 ERIADLYQLDMCTKVNITERVRVKREAAEKCHEILRKQICEDYERKIRSDAELRENKMMENRFVH 375
            :|:..          ::.:.:|:  :..||.:|.::|| .|.::.|...|..::.||:::..   
Zfish   387 DRLMK----------DVMDTLRL--QIQEKLNENMQKQ-AEAFKEKEELDRIIQANKLLDEE--- 435

  Fly   376 PEVTHEMIACRQIQHKADLDAQIKEMKRIQE----EEEKRFDSRLM 417
             |..|...|.::.|  |||.||:...:||:|    |:|..|...||
Zfish   436 -EKAHFREATKEYQ--ADLLAQMMYRQRIREAEEAEKEYEFQKGLM 478

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34425NP_001097683.1 PTZ00121 <29..402 CDD:173412 99/416 (24%)
cfap53NP_001038595.2 TPH 160..493 CDD:290579 92/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31183
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.