DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34425 and cfap53

Sequence 1:NP_001097683.1 Gene:CG34425 FlyBaseID:FBgn0085454 Length:532 Species:Drosophila melanogaster
Sequence 2:NP_001120281.1 Gene:cfap53 XenbaseID:XB-GENE-988466 Length:516 Species:Xenopus tropicalis

Alignment Length:474 Identity:113/475 (24%)
Similarity:214/475 (45%) Gaps:58/475 (12%)


  Fly    17 TDRKSLHTQIGLLVNKAKEVTAAELHERSKRLKNMLDEEDKRYEEEFSNTVKNRIDQDIKERKEH 81
            |::|.||..:...|.:..:.....|.||.:||..:|:.|:..:.:|.....:..:::..|.| |.
 Frog    71 TEKKLLHNTVQRAVYRTMQEYKMHLEERRERLSTLLEREEMEHIKEMEAMEETTLERQAKMR-ER 134

  Fly    82 LHAIKEQVAKQQKKFLEEKHIQQVMLDCYEIREALR---HQDLVETKIVQEEQILENQRKKRREC 143
            :.:::|:..|::..|:.||..||....|.|:| :||   |.:.|.|:.:.:..:.|...::|:| 
 Frog   135 VKSLREKREKERMDFVAEKREQQFRDQCEELR-SLRSQIHLNEVCTERMAQIALKEEINRQRKE- 197

  Fly   144 QQDNYWLELNRRRWAQFDCNQAEENQRRHQMQQQVNHVLA-VQVAEHEEKRKAALAERMEDERLI 207
             :|..:.:|    |......:.|:.:::.|.:.::|..:| :|.|..|.::......:.|:.:|:
 Frog   198 -EDTIFDQL----WEHDRLAKEEQEEKKRQKRMELNQEIASLQKAASEAQKMQEKWLKDEESKLV 257

  Fly   208 NSLLEEIRLEEFEKEHQAAPVDQLAYQ-DELLKEIERKRCARLAEWEAEKANHVAFCRETQRLEA 271
               .||.||.:.|:|.......|...| ..:|::..|.:..|||..:.|:.          .|:.
 Frog   258 ---AEERRLIKLEEERSLKEKQQNRLQVKSMLEDSIRLKMKRLAREQQEEL----------ALDM 309

  Fly   272 EALANIAQS-----------KKDLNRATLEYLAYLRRMQSLELGIEKMMDERIADLYQLDMCTKV 325
            :.|.::.|.           |.:|.:....|..||.:....|...|:.||:.|....:.....| 
 Frog   310 KILEHVMQGYQDDTEEKRQRKMELKKEQQIYREYLAQQLEEEKRQEREMDKMIEAELEKSWAKK- 373

  Fly   326 NITERVRVKREAAEK----CHEILRKQICEDYERKIRSDAELRENKMMENRFV--HPEVTHEMIA 384
              ||::|.::||..:    ..::.|.||.|..|:..:...||.::|.:..|..  |.::..|..|
 Frog   374 --TEQMRKEKEARNRLMKDVMDMRRVQIQEKLEKNAKLQEELAQDKELLQRATEEHKQLETERNA 436

  Fly   385 CRQI----QHKADLDAQI---KEMKRIQEEEEKRFDSRLMAAVDDPVLCKRLAKEILDNG-VDYL 441
             ||:    |::.||.:|:   :..::.:.|||:|.....|||   ....:...:|||... |.:.
 Frog   437 -RQMNLAQQYQQDLLSQVAYQQWQRQAEREEEQREYEAGMAA---EKAYQNTLREILSRPYVGHE 497

  Fly   442 APHPNWRVMACNPNKYIPR 460
            ..||..|....:|..::|:
 Frog   498 NIHPLRRGRISSPKDWLPQ 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34425NP_001097683.1 PTZ00121 <29..402 CDD:173412 93/402 (23%)
cfap53NP_001120281.1 TPH 161..491 CDD:290579 84/357 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.