DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and TOM71

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_011985.1 Gene:TOM71 SGDID:S000001159 Length:639 Species:Saccharomyces cerevisiae

Alignment Length:224 Identity:50/225 (22%)
Similarity:89/225 (40%) Gaps:46/225 (20%)


  Fly    34 NEEEAE---GQEKPKRSLKSSTITEESFIITERKTPIPVISAPTSSKEKSKPRTFNRIDRSKDRF 95
            |..::|   ||.:.:..||...               .|:|.....|:|...|..|...:|.:.|
Yeast    51 NRRQSEAFAGQNEDEADLKDDG---------------SVVSGSNKRKKKKNKRKRNNKAKSGEGF 100

  Fly    96 --PFMRQVEMDLDQ-RSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYI 157
              |.:...|.|:.| :..:..:|:..|...:..||..:...|:..|:|.|..|||...:..:.|.
Yeast   101 DYPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYS 165

  Fly   158 NRALCFIKSGKFKRGIVDCDFVLNKLDEK--NLRAWMYRAMAYKGLN------------------ 202
            |.:.|:|.:|..::.|   :|....|:.|  :.:|.:.||.|.:.|.                  
Yeast   166 NISACYISTGDLEKVI---EFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDF 227

  Fly   203 DESNFENCVKYARKFNSKQMDFIDDFLEK 231
            |.::.|..::  |..|.:.|..:::.|.|
Yeast   228 DGASIEPMLE--RNLNKQAMKVLNENLSK 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 18/66 (27%)
TPR repeat 119..147 CDD:276809 9/28 (32%)
TPR repeat 152..183 CDD:276809 7/31 (23%)
TPR repeat 188..216 CDD:276809 8/46 (17%)
TOM71NP_011985.1 3a0801s09 9..636 CDD:273380 50/225 (22%)
TPR_1 127..159 CDD:278916 10/32 (31%)
TPR repeat 127..155 CDD:276809 9/28 (32%)
TPR repeat 160..190 CDD:276809 8/33 (24%)
TPR repeat 195..218 CDD:276809 5/23 (22%)
TPR repeat 345..373 CDD:276809
TPR repeat 378..406 CDD:276809
TPR repeat 411..441 CDD:276809
TPR_1 412..445 CDD:278916
TPR repeat 446..471 CDD:276809
TPR repeat 480..508 CDD:276809
SNAP <487..>591 CDD:305195
TPR repeat 496..559 CDD:276937
TPR repeat 513..559 CDD:276809
TPR repeat 564..588 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.