DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and STI1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_014670.1 Gene:STI1 SGDID:S000005553 Length:589 Species:Saccharomyces cerevisiae

Alignment Length:99 Identity:27/100 (27%)
Similarity:55/100 (55%) Gaps:6/100 (6%)


  Fly   119 AQNFRKLGNAEYRKGNYEAAMKVYTEAIE-NIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNK 182
            |..:::.|||.:...:|:.|::::|:||| :...:|:||.||:.|:....||...:.|.:..: |
Yeast     5 ADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECV-K 68

  Fly   183 LDEKNLRAWMYRAMAYKGLND----ESNFENCVK 212
            ::....:.:.....|:.||.|    |||::..::
Yeast    69 INPSWSKGYNRLGAAHLGLGDLDEAESNYKKALE 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 20/67 (30%)
TPR repeat 119..147 CDD:276809 9/28 (32%)
TPR repeat 152..183 CDD:276809 10/31 (32%)
TPR repeat 188..216 CDD:276809 7/30 (23%)
STI1NP_014670.1 TPR_11 <5..490 CDD:330823 27/100 (27%)
PLN03088 5..>106 CDD:330826 27/100 (27%)
TPR repeat 5..33 CDD:276809 9/28 (32%)
TPR repeat 39..69 CDD:276809 10/31 (32%)
TPR repeat 74..102 CDD:276809 7/28 (25%)
TPR repeat 262..290 CDD:276809
TPR repeat 294..324 CDD:276809
TPR repeat 336..363 CDD:276809
PLN03088 396..>549 CDD:330826
TPR repeat 396..424 CDD:276809
TPR repeat 429..459 CDD:276809
TPR repeat 464..490 CDD:276809
STI1 537..576 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.