DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and SWA2

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_010606.1 Gene:SWA2 SGDID:S000002728 Length:668 Species:Saccharomyces cerevisiae

Alignment Length:280 Identity:52/281 (19%)
Similarity:98/281 (35%) Gaps:78/281 (28%)


  Fly     2 YSLQHPQIDECFL----DSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITE 62
            ||..|.::::..|    ||.:.:     |.|:.:|  .|.....:.|.:.|  .|..|....||:
Yeast   246 YSKTHDKVEDYDLPQVNDSPNRI-----LFEDNEV--VENLPPADNPDQDL--LTDFETKIDITK 301

  Fly    63 RKTP-IPVISAPTS-----------------------------SKEKSKPRTFNRIDRSKDRFPF 97
            |..| :...|:|||                             ||.......||....:....| 
Yeast   302 RTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIP- 365

  Fly    98 MRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYI----N 158
            :..:|:......||:             |.:.::.|:|..:::.|.:::..:..:|.|.|    |
Yeast   366 ISDIELSGYNEFKAK-------------GTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417

  Fly   159 RALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAW---MYRAMAYKGLND---------ESNFENCV 211
            .....:|.|::.:.|.:....| :|...:...|   :..:...:..||         ..:||:..
Yeast   418 IIASQLKIGEYSKSIENSSMAL-ELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLE 481

  Fly   212 KYARKFNSKQ----MDFIDD 227
            .:.:...:.|    .:|.||
Yeast   482 SFKKALETYQELIKKNFFDD 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 13/70 (19%)
TPR repeat 119..147 CDD:276809 4/28 (14%)
TPR repeat 152..183 CDD:276809 8/35 (23%)
TPR repeat 188..216 CDD:276809 5/40 (13%)
SWA2NP_010606.1 CytochromB561_N 8..>102 CDD:286826
Ubiq-assoc 138..179 CDD:286256
TPR repeat 374..402 CDD:276809 6/41 (15%)
TPR_11 376..443 CDD:290150 15/81 (19%)
TPR repeat 407..441 CDD:276809 8/35 (23%)
TPR repeat 467..495 CDD:276809 3/28 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.