DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and TTC4

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_004614.3 Gene:TTC4 / 7268 HGNCID:12394 Length:387 Species:Homo sapiens


Alignment Length:167 Identity:36/167 - (21%)
Similarity:74/167 - (44%) Gaps:23/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DRSKDRFP-FMRQVEMDLDQRSKARL----------ER--ERVAQNFRKLGNAEYRKGNYEAAMK 140
            ::..::.| ||.:...::|.|....|          ||  |..|:.::..||..:::.:|:.|:.
Human    36 EKEFEKVPLFMSRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVI 100

  Fly   141 VYTEAI-ENIRD---SHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGL 201
            .|||.: :...|   :.:||.|||......|.|:..:.|.. ...||...:|:|.:..|:.:..|
Human   101 SYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSALNDVT-AARKLKPCHLKAIIRGALCHLEL 164

  Fly   202 NDESNFENCVKYARKFNSKQMDFID-----DFLEKLK 233
            ...:...|......:.::|:...::     |.|::::
Human   165 KHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 19/69 (28%)
TPR repeat 119..147 CDD:276809 8/28 (29%)
TPR repeat 152..183 CDD:276809 8/30 (27%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
TTC4NP_004614.3 TPR_11 78..148 CDD:290150 19/70 (27%)
TPR 1 79..112 8/32 (25%)
TPR repeat 79..107 CDD:276809 8/27 (30%)
TPR repeat 116..146 CDD:276809 8/30 (27%)
TPR 2 117..150 10/33 (30%)
TPR_16 123..181 CDD:290168 12/58 (21%)
TPR 3 151..184 5/32 (16%)
TPR repeat 151..179 CDD:276809 5/27 (19%)
NinG 173..>236 CDD:283434 3/29 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.