DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and Sugt1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_080750.1 Gene:Sugt1 MGIID:1915205 Length:336 Species:Mus musculus

Alignment Length:84 Identity:25/85 (29%)
Similarity:35/85 (41%) Gaps:23/85 (27%)


  Fly   133 GNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMA 197
            |:.:||::..|:|:|...|....|..||.|.|..||::.||.|.        :|:|         
Mouse    25 GDPQAALEELTKALEQNPDDAQYYCQRAYCHILLGKYRDGIADV--------KKSL--------- 72

  Fly   198 YKGLNDESNFENCVKYARK 216
                  |.|..||....||
Mouse    73 ------ELNPNNCTALLRK 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 17/52 (33%)
TPR repeat 119..147 CDD:276809 5/14 (36%)
TPR repeat 152..183 CDD:276809 10/31 (32%)
TPR repeat 188..216 CDD:276809 6/28 (21%)
Sugt1NP_080750.1 TPR 1 11..44 7/19 (37%)
PLN03088 21..336 CDD:215568 25/85 (29%)
Motor_domain <38..>107 CDD:277568 20/72 (28%)
TPR repeat 44..74 CDD:276809 13/53 (25%)
TPR 2 45..78 14/56 (25%)
TPR 45..78 CDD:197478 14/56 (25%)
TPR 3 79..112 3/8 (38%)
TPR repeat 79..107 CDD:276809 3/8 (38%)
p23_CS_hSgt1_like 146..229 CDD:107239
SGS 256..336 CDD:282811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.