DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and CG34274

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001097807.1 Gene:CG34274 FlyBaseID:FBgn0085303 Length:250 Species:Drosophila melanogaster

Alignment Length:234 Identity:104/235 (44%)
Similarity:147/235 (63%) Gaps:14/235 (6%)


  Fly     1 MYSLQHPQIDECFLDSEST-VEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERK 64
            ::..|||..||.||..:.| ||:|:..|:.|:..|:.::    ..||...:.|:.:...|:|.|.
  Fly    27 LFIYQHPAADESFLKEQPTKVEDVIEYLDVLENANKTDS----SKKRQKSTITMDDIKCIVTRRS 87

  Fly    65 TPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAE 129
                .:|..|..:.|:|....|     .::|.||||::.:.|.|..||.:||.||:.||::||.|
  Fly    88 ----AVSTTTFRRGKAKRALIN-----TNQFTFMRQIDSEPDDRVLAREQREDVAETFRRMGNYE 143

  Fly   130 YRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYR 194
            |||.|:..|...|::.|:.|:||.:||:||||||||..:||.||:|||:||.|:||..||||:||
  Fly   144 YRKLNFSLAKDYYSKGIQYIKDSPVLYVNRALCFIKLREFKLGIIDCDYVLAKIDEHYLRAWLYR 208

  Fly   195 AMAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            |.|||.||||.|||..|..||:||....||||:||:|::
  Fly   209 AAAYKRLNDEPNFEYSVDRARRFNRSDADFIDEFLDKMR 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 37/66 (56%)
TPR repeat 119..147 CDD:276809 13/28 (46%)
TPR repeat 152..183 CDD:276809 21/31 (68%)
TPR repeat 188..216 CDD:276809 20/28 (71%)
CG34274NP_001097807.1 TPR_11 133..195 CDD:290150 35/62 (56%)
TPR repeat 133..161 CDD:276809 13/28 (46%)
TPR repeat 166..197 CDD:276809 21/31 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133360654
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46540
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.