DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and ttc12

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_009289931.1 Gene:ttc12 ZFINID:ZDB-GENE-071016-4 Length:707 Species:Danio rerio

Alignment Length:225 Identity:67/226 (30%)
Similarity:110/226 (49%) Gaps:17/226 (8%)


  Fly    11 ECFLDSESTVEEVVRLLENLQVPNEEEAEGQEK---PKRSLKSSTITEESFIITERKTPIPVISA 72
            |.||.....:.|:||.|      |..||..||.   ....|.||...:|.|     ||.|.....
Zfish    15 EKFLRDVDQINELVRDL------NSSEASCQENAIVKTEQLISSLEQKEQF-----KTKINKTVI 68

  Fly    73 PTSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEA 137
            .|||.| :.|... |.:.|::...|::.:|.|.:.|.:.|..:|..|...|:.||..:.:|:||.
Zfish    69 NTSSSE-NNPLNI-RYESSQNPENFLKILEKDAEDRCQRRKMKEERANVLREQGNEAFTQGDYET 131

  Fly   138 AMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLN 202
            |::.|||.:|.:||...||.|||..|||..::|..|.||::.| :.:||.::|:::...::..|.
Zfish   132 AVRFYTEGLEQLRDMQALYTNRAQAFIKLKRYKEAISDCEWAL-RCNEKCIKAFIHMGTSHLALK 195

  Fly   203 DESNFENCVKYARKFNSKQMDFIDDFLEKL 232
            |.:....|.:...:...::...:..:|.::
Zfish   196 DFTQSRICYRKILEIEPQRETMVKAYLRRV 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 27/66 (41%)
TPR repeat 119..147 CDD:276809 11/28 (39%)
TPR repeat 152..183 CDD:276809 13/31 (42%)
TPR repeat 188..216 CDD:276809 4/28 (14%)
ttc12XP_009289931.1 TPR_11 112..178 CDD:290150 27/67 (40%)
TPR repeat 113..141 CDD:276809 11/28 (39%)
TPR repeat 146..176 CDD:276809 13/31 (42%)
TPR_11 149..212 CDD:290150 19/64 (30%)
TPR_1 150..180 CDD:278916 14/31 (45%)
TPR repeat 181..209 CDD:276809 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T595987
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.