DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and TTC12

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005271661.1 Gene:TTC12 HGNCID:23700 Length:777 Species:Homo sapiens

Alignment Length:219 Identity:61/220 (28%)
Similarity:104/220 (47%) Gaps:22/220 (10%)


  Fly    20 VEEVVRLLENLQVPNEEEAEGQEK-----PKRSLKSSTITEESFI-ITERKTPIPVISAPTSSKE 78
            |:|:..|::.:   |.::...|:|     .||.|......||... .|..||.|           
Human    16 VDEISNLIQEM---NSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTTLNKTMI----------- 66

  Fly    79 KSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYT 143
             |.|:|..:.....:...|:..||.|..:|:|.|.|.:.:|...::.||..:.:||||.|:..|:
Human    67 -SPPQTAMKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAILRYS 130

  Fly   144 EAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNFE 208
            |.:|.::|..:||.|||..::|...:::.:|||::.| |.|||..:|:.:...|...|.:.|...
Human   131 EGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWAL-KCDEKCTKAYFHMGKANLALKNYSVSR 194

  Fly   209 NCVKYARKFNSKQMDFIDDFLEKL 232
            .|.|...:.|.|....:..:|.::
Human   195 ECYKKILEINPKLQTQVKGYLNQV 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 24/66 (36%)
TPR repeat 119..147 CDD:276809 10/28 (36%)
TPR repeat 152..183 CDD:276809 11/31 (35%)
TPR repeat 188..216 CDD:276809 6/28 (21%)
TTC12XP_005271661.1 TPR_11 106..171 CDD:290150 24/66 (36%)
BamD 106..>164 CDD:276939 21/58 (36%)
TPR repeat 106..138 CDD:276939 11/32 (34%)
TPR repeat 106..134 CDD:276809 10/28 (36%)
TPR repeat 139..169 CDD:276809 11/31 (35%)
TPR_11 142..205 CDD:290150 21/64 (33%)
TPR_1 143..173 CDD:278916 13/31 (42%)
TPR repeat 174..202 CDD:276809 6/28 (21%)
TPR repeat 211..236 CDD:276809 1/9 (11%)
ARM 526..631 CDD:237987
armadillo repeat 555..591 CDD:293788
armadillo repeat 597..631 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T608481
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.