DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and sugt1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001016156.1 Gene:sugt1 XenbaseID:XB-GENE-919559 Length:330 Species:Xenopus tropicalis

Alignment Length:103 Identity:26/104 (25%)
Similarity:42/104 (40%) Gaps:8/104 (8%)


  Fly    60 ITERKTPIPVISAPTS----SKEKSKPRTFNRIDRSKDRFPFMRQ---VEMDLDQRSKARLERER 117
            :|||..| |.:|...|    ..:||.......|:...|...:..|   ..:.|...:.|.|:.:|
 Frog     1 MTERAVP-PTLSFTDSYIGADPQKSLEELTKAIEEKSDCAEYYCQRAYAHILLQNYNDAVLDAKR 64

  Fly   118 VAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHIL 155
            ..:......:|..|||..|..::.|:.|.|:.:...||
 Frog    65 SLELQPNNASAFLRKGEAEFHLQNYSSAEESFKKGQIL 102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 10/38 (26%)
TPR repeat 119..147 CDD:276809 7/28 (25%)
TPR repeat 152..183 CDD:276809 2/5 (40%)
TPR repeat 188..216 CDD:276809
sugt1NP_001016156.1 PLN03088 15..330 CDD:330826 20/89 (22%)
TPR repeat 38..68 CDD:276809 5/30 (17%)
TPR repeat 73..98 CDD:276809 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.