DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and sugt1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001007362.1 Gene:sugt1 ZFINID:ZDB-GENE-041114-56 Length:322 Species:Danio rerio

Alignment Length:65 Identity:18/66 (27%)
Similarity:32/66 (48%) Gaps:3/66 (5%)


  Fly   105 LDQRSKARLERERVAQNFRKLGNAEY--RKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSG 167
            :|:..:..||....|.. .|..|||:  ::......:|.||:||::.:.:..|....||.|::.|
Zfish    12 IDEDPRRALEELNEALG-EKADNAEWLCQRAYAYILLKEYTKAIDDAKKAQDLQPGLALPFLRIG 75

  Fly   168  167
            Zfish    76  75

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 15/52 (29%)
TPR repeat 119..147 CDD:276809 10/30 (33%)
TPR repeat 152..183 CDD:276809 5/17 (29%)
TPR repeat 188..216 CDD:276809
sugt1NP_001007362.1 PLN03088 10..322 CDD:215568 18/66 (27%)
TPR repeat 33..63 CDD:276809 8/30 (27%)
TPR_1 34..65 CDD:278916 8/31 (26%)
TPR repeat 68..91 CDD:276809 4/9 (44%)
p23_CS_hSgt1_like 135..218 CDD:107239
SGS 242..322 CDD:282811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.