powered by:
Protein Alignment: CG34297 and sugt1
Sequence 1: | NP_001097696.1 |
Gene: | CG34297 |
FlyBaseID: | FBgn0085326 |
Length: | 233 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001007362.1 |
Gene: | sugt1 |
ZFINID: | ZDB-GENE-041114-56 |
Length: | 322 |
Species: | Danio rerio |
Alignment Length: | 65 |
Identity: | 18/66 (27%) |
Similarity: | 32/66 (48%) |
Gaps: | 3/66 (5%) |
Fly 105 LDQRSKARLERERVAQNFRKLGNAEY--RKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSG 167
:|:..:..||....|.. .|..|||: ::......:|.||:||::.:.:..|....||.|::.|
Zfish 12 IDEDPRRALEELNEALG-EKADNAEWLCQRAYAYILLKEYTKAIDDAKKAQDLQPGLALPFLRIG 75
Fly 168 167
Zfish 76 75
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E2759_KOG0548 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.