DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and CG6980

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster

Alignment Length:233 Identity:83/234 (35%)
Similarity:133/234 (57%) Gaps:17/234 (7%)


  Fly     6 HPQIDECFLDSESTVEEVVRLLENLQVPNEEE---AEGQEKPKRSLKSSTITEESFIITERKTPI 67
            :|.:.:.|.:.|:|:.::..:|:| :.|.::|   |.|..|.|.:..:..:.:....:.|.:|  
  Fly    22 NPSVADDFAEFEATLAKIDCILQN-KAPCDDEDSKAGGDAKEKINFDNLDVDKVRLKVKENRT-- 83

  Fly    68 PVISAPTSSKEKSKPRTFNRIDRSKD--RFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEY 130
             ||:..:..::..|        :.||  :..||.|||.|.:.|::||.:.|..|:..|..||..:
  Fly    84 -VINRKSLEEDNEK--------QVKDMNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAF 139

  Fly   131 RKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRA 195
            |...||.|:..|.:||..::||.|.|.|||||:||...:||.:.||.:||.||.|.|||||:|:|
  Fly   140 RSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAWLYQA 204

  Fly   196 MAYKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            .|||||..:..||..|..||:.|.||:.:||.::::|:
  Fly   205 HAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLE 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 30/66 (45%)
TPR repeat 119..147 CDD:276809 11/28 (39%)
TPR repeat 152..183 CDD:276809 17/31 (55%)
TPR repeat 188..216 CDD:276809 16/28 (57%)
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 28/63 (44%)
TPR repeat 128..156 CDD:276809 11/28 (39%)
TPR repeat 161..192 CDD:276809 17/31 (55%)
TPR_1 162..190 CDD:278916 15/28 (54%)
TPR repeat 197..225 CDD:276809 16/28 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133360546
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46540
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
54.960

Return to query results.
Submit another query.