DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and stip1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_989360.1 Gene:stip1 XenbaseID:XB-GENE-958361 Length:543 Species:Xenopus tropicalis

Alignment Length:159 Identity:45/160 (28%)
Similarity:77/160 (48%) Gaps:12/160 (8%)


  Fly    77 KEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQ-------NFRKLGNAEYRKGN 134
            |.|.....||: ..::.|.|   :|.....|..|...|:||:|.       ..:..||..::||:
 Frog   315 KNKEAIHFFNK-SLAEHRTP---EVLKKCQQAEKILKEQERLAYINPDLALEEKSKGNESFQKGD 375

  Fly   135 YEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYK 199
            |..|||.|||||:...:...||.|||.|:.|..:|:..:.||:..: :|:.|.::.:..:|.|.:
 Frog   376 YPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECI-RLEPKFIKGYTRKAAALE 439

  Fly   200 GLNDESNFENCVKYARKFNSKQMDFIDDF 228
            .:.|.|...:..:.|.:.:|...:..|.:
 Frog   440 AMKDYSKAMDVYQKAMELDSTCKEATDGY 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 25/73 (34%)
TPR repeat 119..147 CDD:276809 14/35 (40%)
TPR repeat 152..183 CDD:276809 10/31 (32%)
TPR repeat 188..216 CDD:276809 5/28 (18%)
stip1NP_989360.1 PLN03088 <2..532 CDD:330826 45/160 (28%)
TPR repeat 4..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR repeat 72..100 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR repeat 300..328 CDD:276809 4/14 (29%)
TPR repeat 364..388 CDD:276809 13/24 (54%)
TPR repeat 393..423 CDD:276809 10/31 (32%)
TPR repeat 428..456 CDD:276809 5/28 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.