DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and CG43163

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001246673.1 Gene:CG43163 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster

Alignment Length:60 Identity:20/61 (33%)
Similarity:35/61 (57%) Gaps:5/61 (8%)


  Fly   116 ERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVD 175
            |:|.|:     ||..:.|::..|:.:||:|::....:||||.||:...:|.|:|...:.|
  Fly    67 EKVRQS-----NAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQD 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 18/58 (31%)
TPR repeat 119..147 CDD:276809 8/28 (29%)
TPR repeat 152..183 CDD:276809 10/25 (40%)
TPR repeat 188..216 CDD:276809
CG43163NP_001246673.1 TPR_11 70..130 CDD:290150 18/58 (31%)
TPR repeat 98..128 CDD:276809 10/25 (40%)
TPR_11 101..164 CDD:290150 8/22 (36%)
TPR repeat 133..161 CDD:276809
TPR repeat 243..269 CDD:276809
TPR repeat 281..311 CDD:276809
TPR_12 282..353 CDD:290160
TPR_12 320..393 CDD:290160
TPR repeat 321..349 CDD:276809
TPR repeat 354..390 CDD:276809
TPR_12 401..473 CDD:290160
TPR repeat 401..429 CDD:276809
TPR_7 403..438 CDD:289919
TPR repeat 441..469 CDD:276809
TPR 467..752 CDD:223533
TPR repeat 482..509 CDD:276809
TPR repeat 522..549 CDD:276809
TPR repeat 561..595 CDD:276809
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR_7 643..677 CDD:289919
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_7 723..758 CDD:289919
TPR repeat 801..829 CDD:276809
TPR_12 841..914 CDD:290160
TPR repeat 841..878 CDD:276809
TPR_12 882..949 CDD:290160
TPR repeat 883..913 CDD:276809
TPR 884..914 CDD:197478
TPR repeat 924..949 CDD:276809
TPR_12 964..1036 CDD:290160
TPR repeat 964..998 CDD:276809
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR_12 1044..1112 CDD:290160
TPR_7 1046..1078 CDD:289919
TPR_12 1081..1153 CDD:290160
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:289536
Treacle <1957..2287 CDD:281536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.