DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Dpit47

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster


Alignment Length:211 Identity:42/211 - (19%)
Similarity:81/211 - (38%) Gaps:32/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISAPTSSKEKSKPR 83
            |.||.:.|...|....:...:|.||.:        .||.:  .|.:....:...|...|...:|.
  Fly    11 TDEERLELAAQLDAELDAFIDGLEKKR--------YEEGW--PEDRWQEEMDKHPFFMKRAPQPG 65

  Fly    84 TFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIEN 148
                 |.....|..:::::.|.::.:     |:.:|.|:::.||...:...:..|:..:||.|:.
  Fly    66 -----DDVHPMFEGLQKLKYDPEENT-----RDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKT 120

  Fly   149 IRDS----HILYINRALC--FIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNF 207
            ..|:    .:||.||:..  |||:  ::..:.|....|....:.....|.....||    :...|
  Fly   121 KTDNPDVLAVLYNNRSAAHFFIKN--YRSSLSDAQRALFYKPDYTKARWRSAQCAY----ELERF 179

  Fly   208 ENCVKYARKFNSKQMD 223
            :.|.:...:.....:|
  Fly   180 DLCTQMCEELLEVDVD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 18/71 (25%)
TPR repeat 119..147 CDD:276809 7/27 (26%)
TPR repeat 152..183 CDD:276809 9/36 (25%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 22/105 (21%)
TPR repeat 91..119 CDD:276809 7/27 (26%)
TPR repeat 124..158 CDD:276809 9/35 (26%)
TPR repeat 163..191 CDD:276809 5/31 (16%)
TPR repeat 197..227 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.