DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and CG31294

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_732055.1 Gene:CG31294 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster

Alignment Length:231 Identity:89/232 (38%)
Similarity:133/232 (57%) Gaps:19/232 (8%)


  Fly    10 DECFLDSESTVEEVVRLLENLQVPNEEE--AEGQEKPKRSL-KSSTITEESFIITERKTPIPVIS 71
            ||.||:..|.:.:|::.||:||..|:.:  .:|:|:.|..: .|..:|..:|::..|..      
  Fly     4 DESFLNQRSLLMDVMKQLEDLQNANKMDTGTKGKEEKKPEVDPSEGVTITNFMVFARDV------ 62

  Fly    72 APTSSKEKSKPRTFNRIDRSK--DRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGN 134
                  .|...|...|:.:..  ::..||||:::....|::||.:||.||.:||:|||.|||:.|
  Fly    63 ------RKKSSRYLKRVQKMSNINQISFMRQIDVSPKDRAEARRDREIVADSFRRLGNEEYRRTN 121

  Fly   135 YEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYK 199
            ||.|:..|::||:.:.||.:||.||||..||...||..:.|.|:|:..||..:||||:|||.|..
  Fly   122 YEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVIFNLDPIHLRAWLYRAGALA 186

  Fly   200 GLNDESNFENCVKYARKFNSKQMD--FIDDFLEKLK 233
            .||:||.||..:..||..|..|.|  :|:.||||.|
  Fly   187 RLNNESEFEIAIANARLLNRSQKDKKYIEYFLEKFK 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 33/66 (50%)
TPR repeat 119..147 CDD:276809 16/28 (57%)
TPR repeat 152..183 CDD:276809 14/31 (45%)
TPR repeat 188..216 CDD:276809 16/28 (57%)
CG31294NP_732055.1 TPR_11 106..172 CDD:290150 33/66 (50%)
TPR repeat 106..134 CDD:276809 16/28 (57%)
TPR repeat 139..170 CDD:276809 14/31 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133360602
eggNOG 1 0.900 E2759_KOG0548
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46540
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.