DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and Ttc12

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006243066.1 Gene:Ttc12 RGDID:1303264 Length:723 Species:Rattus norvegicus

Alignment Length:224 Identity:60/225 (27%)
Similarity:106/225 (47%) Gaps:27/225 (12%)


  Fly    22 EVVRLLENL-QVPNEEEAEGQEKPKRSLKSSTITEESFIITER------------KTPIPVISAP 73
            ::.|.|||: ::.|..:....:.|....|:...||:..::.||            ||.|....||
  Rat    27 DLQRFLENVDEITNLIQEMNSDDPFIQQKAVLDTEKKLLLMEREQEEDGCRTTLNKTMISPPQAP 91

  Fly    74 TSSKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAA 138
            .::.|.:..             .|:..||.|..:|:|.|.|...:|...::.||..:.||:||.|
  Rat    92 ENANEMNPD-------------AFLASVEKDAKERAKRRRENRVLADALKEKGNEAFVKGDYETA 143

  Fly   139 MKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLND 203
            :..|:|.:..::|..:||.|||..:||.|.:::.:||||:.| |.||...:|:.:...|:..|.:
  Rat   144 IFFYSEGLGKLKDMKVLYTNRAQAYIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGKAHLALKN 207

  Fly   204 ESNFENCVKYARKFNSKQMDFIDDFLEKL 232
            .|..:.|.:...:.|.|....:.:.|.::
  Rat   208 YSKSKECYQKIGEINPKLKAQVKEHLNQV 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 26/66 (39%)
TPR repeat 119..147 CDD:276809 10/28 (36%)
TPR repeat 152..183 CDD:276809 14/31 (45%)
TPR repeat 188..216 CDD:276809 5/28 (18%)
Ttc12XP_006243066.1 TPR_11 124..189 CDD:290150 26/66 (39%)
TPR repeat 124..152 CDD:276809 10/28 (36%)
TPR repeat 157..187 CDD:276809 14/31 (45%)
TPR_11 160..223 CDD:290150 22/64 (34%)
TPR_1 161..191 CDD:278916 15/31 (48%)
TPR repeat 192..217 CDD:276809 5/25 (20%)
TPR_1 193..224 CDD:278916 6/31 (19%)
ARM 631..723 CDD:237987
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T617415
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.