DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and Sugt1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001013069.1 Gene:Sugt1 / 290408 RGDID:1307550 Length:336 Species:Rattus norvegicus


Alignment Length:101 Identity:29/101 - (28%)
Similarity:44/101 - (43%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMA 197
            |:.:||::..|:|:|...|....|..||.|.|..||:..||.|....| :|:..|     ..|:.
  Rat    25 GDPQAALEELTKALEQNPDDAQYYCQRAYCHILLGKYCDGIADVKKSL-ELNPNN-----STALL 83

  Fly   198 YKGLNDESNFENCVKYARKFNSKQMDFIDDFLEKLK 233
            .||:        |..|.:.:.|.    ::.|.|..|
  Rat    84 RKGI--------CEYYEKDYASA----LETFAEGQK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 19/51 (37%)
TPR repeat 119..147 CDD:276809 5/13 (38%)
TPR repeat 152..183 CDD:276809 11/30 (37%)
TPR repeat 188..216 CDD:276809 5/27 (19%)
Sugt1NP_001013069.1 TPR 1 11..44 6/18 (33%)
PLN03088 21..336 CDD:215568 29/101 (29%)
TPR repeat 44..74 CDD:276809 11/30 (37%)
TPR 2 45..78 12/33 (36%)
TPR 45..78 CDD:197478 12/33 (36%)
TPR 3 79..112 9/41 (22%)
TPR repeat 79..107 CDD:276809 8/39 (21%)
p23_CS_hSgt1_like 146..229 CDD:107239
SGS 256..336 CDD:282811
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.