DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and ucp7

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_593480.1 Gene:ucp7 PomBaseID:SPAC17A5.12 Length:697 Species:Schizosaccharomyces pombe

Alignment Length:257 Identity:50/258 (19%)
Similarity:91/258 (35%) Gaps:65/258 (25%)


  Fly    17 ESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISAPTSSKEKSK 81
            |:|.|    :|....:|       :.||.:...:..::|:.....:.:          |..::|.
pombe   303 EATPE----ILPKTPIP-------KRKPHKVPMNEKVSEDRITTNQSR----------SGNDESS 346

  Fly    82 PRTF--NRIDRSKDRFP------------------FMRQVEMDLDQRSKARLERERVAQNF---- 122
            ...|  ::.|.|...||                  ..|||..:...:|..:...|....|.    
pombe   347 LVDFLTSKSDNSSFNFPSDTYEGTENILETAYESTTARQVNNNKPGKSTVKKREEETLNNMVSAL 411

  Fly   123 ----RKLGNAEYRKGNYEAAMKVYTEAIENIRDSHI----LYINRALCFIKSGKFKRGIVDCDFV 179
                :..||..:|||::..|::.:|.::..:...|.    |..||:||:.|.|..|..:.|.|.:
pombe   412 VEEQQSTGNELFRKGDFSQAIEEFTNSLSQLPAKHTKRVPLLSNRSLCYQKVGDLKTCLQDVDEL 476

  Fly   180 LNKLDEKNLRAWMYRAMAYKGLND---------ESNFENCVKYARKFNSKQMDFIDDFLEKL 232
            ::.:.|:....   .::..|.:||         ....|...||....|..:....|..:.||
pombe   477 VDIIGEEKGHG---ESIRDKSMNDYYVKNMVRKAQVLEQLEKYQESLNIWKDLIADGQISKL 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 19/78 (24%)
TPR repeat 119..147 CDD:276809 8/36 (22%)
TPR repeat 152..183 CDD:276809 11/35 (31%)
TPR repeat 188..216 CDD:276809 6/37 (16%)
ucp7NP_593480.1 UBA 183..218 CDD:279021
TPR_11 419..479 CDD:290150 18/60 (30%)
TPR repeat 449..479 CDD:276809 10/30 (33%)
TPR repeat 500..528 CDD:276809 4/28 (14%)
PKc_like <568..638 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.