DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and Ttc12

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_766358.1 Gene:Ttc12 MGIID:2444588 Length:704 Species:Mus musculus

Alignment Length:221 Identity:59/222 (27%)
Similarity:107/222 (48%) Gaps:16/222 (7%)


  Fly    13 FLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISAPTSSK 77
            ||::   |:|:..|::.:         ..:.|....|:...:|:..::.||:..........:..
Mouse    12 FLEN---VDEITSLIQEM---------NSDDPFIQQKAVLDSEKKLLLMEREQEEDGCRTTLNKT 64

  Fly    78 EKSKPRTFNRIDR-SKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKV 141
            ..|.|:|....|. |.|  .|:..||.|..:|:|.|.|...:|...::.||..:.:|:||.|:..
Mouse    65 MISPPQTPENADEMSPD--AFLASVEKDAKERAKRRRENRVLADALKEKGNEAFVRGDYETAIFF 127

  Fly   142 YTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESN 206
            |:|.:..::|..:||.|||..|||.|.:::.:||||:.| |.||...:|:.:...|:..|.:.|.
Mouse   128 YSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWAL-KCDENCTKAYFHMGKAHVALKNYSK 191

  Fly   207 FENCVKYARKFNSKQMDFIDDFLEKL 232
            .:.|.:...:.|.|....:.:.|.::
Mouse   192 AKECYQKIEEINPKLKAQVKEHLNQV 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 26/66 (39%)
TPR repeat 119..147 CDD:276809 9/28 (32%)
TPR repeat 152..183 CDD:276809 15/31 (48%)
TPR repeat 188..216 CDD:276809 5/28 (18%)
Ttc12NP_766358.1 TPR_11 105..170 CDD:290150 26/66 (39%)
TPR 1 105..138 10/33 (30%)
TPR repeat 105..133 CDD:276809 9/28 (32%)
TPR repeat 138..168 CDD:276809 15/31 (48%)
TPR 2 139..172 17/34 (50%)
TPR_11 141..204 CDD:290150 23/64 (36%)
TPR_1 142..172 CDD:278916 16/31 (52%)
TPR 3 173..206 7/33 (21%)
TPR repeat 173..198 CDD:276809 5/25 (20%)
TPR_1 174..205 CDD:278916 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 1 1.000 T615305
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46540
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.