DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and TTC28

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001138890.1 Gene:TTC28 HGNCID:29179 Length:2481 Species:Homo sapiens

Alignment Length:112 Identity:29/113 (26%)
Similarity:44/113 (39%) Gaps:36/113 (32%)


  Fly   117 RVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLN 181
            :|..|   ||.|.|..|||:.|:|.|.:.:...:|.|                           :
Human   635 KVCHN---LGYAHYCLGNYQEAVKYYEQDLALAKDLH---------------------------D 669

  Fly   182 KLDEKNLRAWMYRAMAYKGLNDESNFENCVKY----ARKFNSKQMDF 224
            ||.:  .:|:....:|:|.|.:.|..|.|.||    |:..|:.|..|
Human   670 KLSQ--AKAYCNLGLAFKALLNFSKAEECQKYLLSLAQSLNNSQAKF 714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 15/66 (23%)
TPR repeat 119..147 CDD:276809 11/28 (39%)
TPR repeat 152..183 CDD:276809 2/31 (6%)
TPR repeat 188..216 CDD:276809 10/32 (31%)
TTC28NP_001138890.1 TPR 1 58..91
TPR_11 63..123 CDD:290150
TPR repeat 91..121 CDD:276809
TPR 2 93..125
TPR_11 94..157 CDD:290150
TPR 3 126..159
TPR repeat 126..154 CDD:276809
TPR repeat 160..188 CDD:276809
TPR 4 196..229
TPR 5 234..267
TPR repeat 236..262 CDD:276809
TPR 6 274..307
TPR repeat 274..306 CDD:276809
TPR_11 275..345 CDD:290150
TPR 7 314..347
TPR_12 315..386 CDD:290160
TPR repeat 316..342 CDD:276809
TPR 8 354..387
TPR repeat 354..382 CDD:276809
TPR_7 357..391 CDD:289919
TPR repeat 393..423 CDD:276809
TPR 9 394..427
TPR 394..426 CDD:197478
TPR 414..717 CDD:223533 29/113 (26%)
TPR repeat 428..459 CDD:276809
TPR 10 434..467
TPR 11 474..507
TPR repeat 475..502 CDD:276809
TPR 12 514..547
TPR repeat 515..542 CDD:276809
TPR_7 516..551 CDD:289919
TPR 13 554..587
TPR repeat 554..582 CDD:276809
TPR 14 594..627
TPR repeat 594..622 CDD:276809
TPR_7 596..631 CDD:289919
TPR repeat 633..663 CDD:276809 12/31 (39%)
TPR 15 634..667 13/35 (37%)
TPR_7 636..670 CDD:289919 14/64 (22%)
TPR 16 674..707 10/33 (30%)
TPR 694..995 CDD:223533 8/22 (36%)
TPR repeat 712..739 CDD:276809 1/4 (25%)
TPR 17 714..747 1/2 (50%)
TPR 18 754..787
TPR repeat 754..782 CDD:276809
TPR 19 794..827
TPR repeat 794..822 CDD:276809
TPR repeat 833..863 CDD:276809
TPR 20 834..867
TPR 21 877..910
TPR repeat 878..905 CDD:276809
TPR_7 879..911 CDD:289919
TPR repeat 916..950 CDD:276809
TPR 22 917..950
TPR 23 957..990
TPR repeat 957..982 CDD:276809
TPR_7 959..994 CDD:289919
TPR 24 997..1030
TPR repeat 997..1025 CDD:276809
TPR_12 999..1067 CDD:290160
TPR 25 1037..1070
TPR repeat 1037..1065 CDD:276809
TPR_12 1038..1109 CDD:290160
TPR repeat 1075..1105 CDD:276809
TPR 26 1077..1110
TPR_12 1079..1148 CDD:290160
TPR 27 1117..1150
TPR repeat 1117..1143 CDD:276809
TPR 28 1169..1202
TPR repeat 1169..1194 CDD:276809
CHAT 1390..1713 CDD:289536
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.