DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34297 and TTC28

DIOPT Version :9

Sequence 1:	NP_001097696.1	Gene:	CG34297 / 5740802	FlyBaseID:	FBgn0085326	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_001138890.1	Gene:	TTC28 / 23331	HGNCID:	29179	Length:	2481	Species:	Homo sapiens

Alignment Length:	112	Identity:	29/112 - (25%)
Similarity:	44/112 - (39%)	Gaps:	36/112 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   117 RVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLN 181
            :|..|   ||.|.|..|||:.|:|.|.:.:...:|.|                           :
Human   635 KVCHN---LGYAHYCLGNYQEAVKYYEQDLALAKDLH---------------------------D 669

  Fly   182 KLDEKNLRAWMYRAMAYKGLNDESNFENCVKY----ARKFNSKQMDF 224
            ||.:  .:|:....:|:|.|.:.|..|.|.||    |:..|:.|..|
Human   670 KLSQ--AKAYCNLGLAFKALLNFSKAEECQKYLLSLAQSLNNSQAKF 714

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34297	NP_001097696.1	TPR_11	119..185	CDD:290150	15/65 (23%)
		TPR repeat	119..147	CDD:276809	11/27 (41%)
		TPR repeat	152..183	CDD:276809	1/30 (3%)
		TPR repeat	188..216	CDD:276809	10/31 (32%)
TTC28	NP_001138890.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..48
		TPR 1	58..91
		TPR_11	63..123	CDD:290150
		TPR repeat	91..121	CDD:276809
		TPR 2	93..125
		TPR_11	94..157	CDD:290150
		TPR 3	126..159
		TPR repeat	126..154	CDD:276809
		TPR repeat	160..188	CDD:276809
		TPR 4	196..229
		TPR 5	234..267
		TPR repeat	236..262	CDD:276809
		TPR 6	274..307
		TPR repeat	274..306	CDD:276809
		TPR_11	275..345	CDD:290150
		TPR 7	314..347
		TPR_12	315..386	CDD:290160
		TPR repeat	316..342	CDD:276809
		TPR 8	354..387
		TPR repeat	354..382	CDD:276809
		TPR_7	357..391	CDD:289919
		TPR repeat	393..423	CDD:276809
		TPR 9	394..427
		TPR	394..426	CDD:197478
		TPR	414..717	CDD:223533	29/112 (26%)
		TPR repeat	428..459	CDD:276809
		TPR 10	434..467
		TPR 11	474..507
		TPR repeat	475..502	CDD:276809
		TPR 12	514..547
		TPR repeat	515..542	CDD:276809
		TPR_7	516..551	CDD:289919
		TPR 13	554..587
		TPR repeat	554..582	CDD:276809
		TPR 14	594..627
		TPR repeat	594..622	CDD:276809
		TPR_7	596..631	CDD:289919
		TPR repeat	633..663	CDD:276809	12/30 (40%)
		TPR 15	634..667		12/34 (35%)
		TPR_7	636..670	CDD:289919	14/63 (22%)
		TPR 16	674..707		10/32 (31%)
		TPR	694..995	CDD:223533	8/21 (38%)
		TPR repeat	712..739	CDD:276809	1/3 (33%)
		TPR 17	714..747		1/1 (100%)
		TPR 18	754..787
		TPR repeat	754..782	CDD:276809
		TPR 19	794..827
		TPR repeat	794..822	CDD:276809
		TPR repeat	833..863	CDD:276809
		TPR 20	834..867
		TPR 21	877..910
		TPR repeat	878..905	CDD:276809
		TPR_7	879..911	CDD:289919
		TPR repeat	916..950	CDD:276809
		TPR 22	917..950
		TPR 23	957..990
		TPR repeat	957..982	CDD:276809
		TPR_7	959..994	CDD:289919
		TPR 24	997..1030
		TPR repeat	997..1025	CDD:276809
		TPR_12	999..1067	CDD:290160
		TPR 25	1037..1070
		TPR repeat	1037..1065	CDD:276809
		TPR_12	1038..1109	CDD:290160
TPR repeat	1075..1105	CDD:276809
TPR 26	1077..1110
TPR_12	1079..1148	CDD:290160
TPR 27	1117..1150
TPR repeat	1117..1143	CDD:276809
TPR 28	1169..1202
TPR repeat	1169..1194	CDD:276809
CHAT	1390..1713	CDD:289536
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2004..2055
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2075..2161
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2176..2339
Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2420..2467
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900