DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and Stip1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_058017.1 Gene:Stip1 MGIID:109130 Length:543 Species:Mus musculus

Alignment Length:205 Identity:47/206 (23%)
Similarity:92/206 (45%) Gaps:38/206 (18%)


  Fly    34 NEEEAEGQEKPKRSLKSSTITEESF---------IITERKTPIPVISAPTSSKEKSKPRTFNRID 89
            |.|:.....|....:.:|...||.:         .:.|.:||..:          .|.:...:|.
Mouse   292 NREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVL----------KKCQQAEKIL 346

  Fly    90 RSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIE-NIRDSH 153
            :.::|..::.. ::.|::::|               ||..::||:|..|||.|||||: |.||:.
Mouse   347 KEQERLAYINP-DLALEEKNK---------------GNECFQKGDYPQAMKHYTEAIKRNPRDAK 395

  Fly   154 ILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDESNFENCVKYARKFN 218
             ||.|||.|:.|..:|:..:.||:..: :|:...::.:..:|.|.:.:.|.:...:..:.|...:
Mouse   396 -LYSNRAACYTKLLEFQLALKDCEECI-QLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLD 458

  Fly   219 SKQMDFIDDF 228
            |...:..|.:
Mouse   459 SSCKEAADGY 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 27/67 (40%)
TPR repeat 119..147 CDD:276809 13/28 (46%)
TPR repeat 152..183 CDD:276809 10/31 (32%)
TPR repeat 188..216 CDD:276809 4/28 (14%)
Stip1NP_058017.1 TPR 1 4..37
TPR_11 6..69 CDD:290150
TPR 7..37 CDD:197478
TPR repeat 7..32 CDD:276809
TPR repeat 37..67 CDD:276809
TPR 2 39..71
TPR_11 40..100 CDD:290150
TPR repeat 72..100 CDD:276809
TPR 3 73..105
Bipartite nuclear localization signal. {ECO:0000255} 222..239
TPR_11 224..287 CDD:290150
TPR 4 225..258
TPR repeat 229..253 CDD:276809
TPR_1 231..258 CDD:278916
TPR_12 255..328 CDD:290160 6/36 (17%)
TPR repeat 258..288 CDD:276809
TPR 5 260..292 47/206 (23%)
TPR 6 300..333 6/33 (18%)
TPR 300..328 CDD:197478 4/28 (14%)
TPR repeat 300..328 CDD:276809 4/28 (14%)
TPR_11 360..425 CDD:290150 29/82 (35%)
TPR 7 360..393 17/48 (35%)
TPR_1 364..393 CDD:278916 16/44 (36%)
TPR repeat 364..388 CDD:276809 14/39 (36%)
TPR_11 393..458 CDD:290150 16/67 (24%)
TPR repeat 393..423 CDD:276809 11/32 (34%)
TPR_1 394..427 CDD:278916 11/35 (31%)
TPR 8 395..427 11/34 (32%)
TPR 9 428..461 5/33 (15%)
TPR repeat 428..456 CDD:276809 4/28 (14%)
STI1 492..531 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.