DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34297 and sti-1

DIOPT Version :9

Sequence 1:NP_001097696.1 Gene:CG34297 / 5740802 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001367444.1 Gene:sti-1 / 178587 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans


Alignment Length:136 Identity:40/136 - (29%)
Similarity:64/136 - (47%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 MRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALC 162
            ::::|..|....:.......:||..:..||..::||:|..||:.|.||::...::.|||.|||.|
 Worm   119 VKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAAC 183

  Fly   163 FIKSGKFKRGIVDCDFVLNKLDEK-------------NLRAWMYRAMAYKGL--NDESNFE---- 208
            ..|..:|:|.:.|||..: :||.|             .:|.|.....||:..  .|.||.|    
 Worm   184 LTKLMEFQRALDDCDTCI-RLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREG 247

  Fly   209 --NCVK 212
              ||::
 Worm   248 VRNCLR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 26/65 (40%)
TPR repeat 119..147 CDD:276809 12/27 (44%)
TPR repeat 152..183 CDD:276809 13/30 (43%)
TPR repeat 188..216 CDD:276809 10/33 (30%)
sti-1NP_001367444.1 3a0801s09 <5..>241 CDD:273380 35/122 (29%)
TPR repeat 5..33 CDD:276809
TPR repeat 38..68 CDD:276809
TPR repeat 80..108 CDD:276809
TPR repeat 140..168 CDD:276809 12/27 (44%)
TPR repeat 173..203 CDD:276809 13/30 (43%)
TPR repeat 208..236 CDD:276809 4/27 (15%)
STI1 259..311 CDD:407696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.