DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG34297 and sti-1

DIOPT Version :9

Sequence 1:	NP_001097696.1	Gene:	CG34297 / 5740802	FlyBaseID:	FBgn0085326	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	NP_001367444.1	Gene:	sti-1 / 178587	WormBaseID:	WBGene00019983	Length:	320	Species:	Caenorhabditis elegans

Alignment Length:	136	Identity:	40/136 - (29%)
Similarity:	64/136 - (47%)	Gaps:	22/136 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 MRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALC 162
            ::::|..|....:.......:||..:..||..::||:|..||:.|.||::...::.|||.|||.|
Worm   119 VKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAAC 183

  Fly   163 FIKSGKFKRGIVDCDFVLNKLDEK-------------NLRAWMYRAMAYKGL--NDESNFE---- 208
            ..|..:|:|.:.|||..: :||.|             .:|.|.....||:..  .|.||.|
Worm   184 LTKLMEFQRALDDCDTCI-RLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREG 247

  Fly   209 --NCVK 212
              ||::
Worm   248 VRNCLR 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG34297	NP_001097696.1	TPR_11	119..185	CDD:290150	26/65 (40%)
		TPR repeat	119..147	CDD:276809	12/27 (44%)
		TPR repeat	152..183	CDD:276809	13/30 (43%)
		TPR repeat	188..216	CDD:276809	10/33 (30%)
sti-1	NP_001367444.1	3a0801s09	<5..>241	CDD:273380	35/122 (29%)
		TPR repeat	5..33	CDD:276809
		TPR repeat	38..68	CDD:276809
		TPR repeat	80..108	CDD:276809
		TPR repeat	140..168	CDD:276809	12/27 (44%)
		TPR repeat	173..203	CDD:276809	13/30 (43%)
		TPR repeat	208..236	CDD:276809	4/27 (15%)
		STI1	259..311	CDD:407696
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0548
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810