DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and sti-1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_503322.1 Gene:sti-1 WormBaseID:WBGene00019983 Length:320 Species:Caenorhabditis elegans

Alignment Length:136 Identity:40/137 (29%)
Similarity:64/137 (47%) Gaps:22/137 (16%)


  Fly    98 MRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIRDSHILYINRALC 162
            ::::|..|....:.......:||..:..||..::||:|..||:.|.||::...::.|||.|||.|
 Worm   119 VKELEKQLKAAERLAYINPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAAC 183

  Fly   163 FIKSGKFKRGIVDCDFVLNKLDEK-------------NLRAWMYRAMAYKGL--NDESNFE---- 208
            ..|..:|:|.:.|||..: :||.|             .:|.|.....||:..  .|.||.|    
 Worm   184 LTKLMEFQRALDDCDTCI-RLDSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREG 247

  Fly   209 --NCVK 212
              ||::
 Worm   248 VRNCLR 253

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 27/66 (41%)
TPR repeat 119..147 CDD:276809 12/28 (43%)
TPR repeat 152..183 CDD:276809 13/31 (42%)
TPR repeat 188..216 CDD:276809 10/34 (29%)
sti-1NP_503322.1 TPR_11 5..67 CDD:290150
TPR_1 5..38 CDD:278916
TPR repeat 5..33 CDD:276809
BamD 7..172 CDD:276939 14/53 (26%)
TPR repeat 7..34 CDD:276939
TPR_12 35..108 CDD:290160
TPR repeat 38..68 CDD:276809
TPR repeat 44..119 CDD:276939 40/137 (29%)
TPR repeat 80..108 CDD:276809
TPR repeat 132..171 CDD:276939 12/39 (31%)
TPR_11 140..204 CDD:290150 26/65 (40%)
TPR repeat 140..168 CDD:276809 12/28 (43%)
TPR repeat 173..203 CDD:276809 13/31 (42%)
TPR repeat 208..236 CDD:276809 4/28 (14%)
STI1 269..308 CDD:128966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.