DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and ttc-4

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_495087.1 Gene:ttc-4 WormBaseID:WBGene00015916 Length:419 Species:Caenorhabditis elegans

Alignment Length:188 Identity:45/189 (24%)
Similarity:78/189 (41%) Gaps:31/189 (16%)


  Fly    74 TSSKEKSKPRTFNRIDRSKDRFP-FMRQVEMDLDQRSKARLE--------------RERVAQNFR 123
            :..||:.||..|:...:..|:.| ||  .||..|.:.:..:|              ::..|::.:
 Worm    37 SDKKEERKPFDFDDWCKEIDQHPAFM--TEMPTDGKYQDTIEALQSMKYDKEDDEDKQMNAEHHK 99

  Fly   124 KLGNAEYRKGNYEAAMKVYTEAI-ENIRD---SHILYINRALCFIKSGKFKRGIVDCDFVLNKLD 184
            :.||..::...|..|...|:..| ||..|   :.:||.|||......|..:..|.||. :..|.|
 Worm   100 EEGNKHFKFKKYRWATDCYSNGIKENSPDRKLNAVLYFNRAAAQKHLGNLRSAIKDCS-MGRKFD 163

  Fly   185 EKNLRAWMYRAMAYKGLNDESNFENCVKYARKF------NSKQMDFIDD---FLEKLK 233
            ..:|:..:..|.....|....:..|.::.::|.      .|...|..||   |:::|:
 Worm   164 PTHLKGVIRGAECLLELEYAKDALNWIESSKKIFAFTKETSDTPDLTDDEKKFIDQLE 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 21/70 (30%)
TPR repeat 119..147 CDD:276809 7/29 (24%)
TPR repeat 152..183 CDD:276809 10/31 (32%)
TPR repeat 188..216 CDD:276809 4/28 (14%)
ttc-4NP_495087.1 TPR_11 94..164 CDD:290150 21/71 (30%)
TPR repeat 95..123 CDD:276809 7/28 (25%)
TPR repeat 132..162 CDD:276809 10/31 (32%)
TPR repeat 167..191 CDD:276809 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R218
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.