DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and SUGT1

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001124384.1 Gene:SUGT1 HGNCID:16987 Length:365 Species:Homo sapiens

Alignment Length:74 Identity:22/75 (29%)
Similarity:34/75 (45%) Gaps:8/75 (11%)


  Fly   136 EAAMKVYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKG 200
            :||::..|:|:|...|....|..||.|.|..|.:...:.|....| :|:..|     ..||..||
Human    28 QAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSL-ELNPNN-----STAMLRKG 86

  Fly   201 LND--ESNF 207
            :.:  |.|:
Human    87 ICEYHEKNY 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 15/49 (31%)
TPR repeat 119..147 CDD:276809 4/11 (36%)
TPR repeat 152..183 CDD:276809 8/31 (26%)
TPR repeat 188..216 CDD:276809 6/23 (26%)
SUGT1NP_001124384.1 TPR 1 11..44 6/16 (38%)
PLN03088 21..365 CDD:330826 22/75 (29%)
TPR repeat 44..74 CDD:276809 8/31 (26%)
TPR 2 45..78 9/34 (26%)
TPR 3 79..112 6/18 (33%)
TPR repeat 79..107 CDD:276809 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0548
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.