DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34297 and ttc12

Sequence 1:NP_001097696.1 Gene:CG34297 FlyBaseID:FBgn0085326 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_017951452.1 Gene:ttc12 XenbaseID:XB-GENE-955705 Length:724 Species:Xenopus tropicalis

Alignment Length:222 Identity:65/223 (29%)
Similarity:110/223 (49%) Gaps:12/223 (5%)


  Fly    11 ECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKSSTITEESFIITERKTPIPVISAPTS 75
            |.||.:...:.::::.|.:....:.:||..:...:.:|..:...::....|..:|.|.  ::|..
 Frog     8 ESFLKNIDEITDIIQDLNSSDESHRQEAFLKADKRLALLKNKDNDDGIRTTANRTVIN--TSPEG 70

  Fly    76 SKEKSKPRTFNRIDRSKDRFPFMRQVEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMK 140
            ..........|:..|.... ..:..:|.|..:|::.|.|...:|...::|||..:.||:||.|:|
 Frog    71 MCASGSTYHANKDSRLMQE-NVLEHLEKDAKERAERRKENTAMANALKELGNKAFSKGDYETAVK 134

  Fly   141 VYTEAIENIRDSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKGLNDES 205
            .|:|.:|.:||..:||.|||..|||..|::..|.||.:.| |.:||..:|:::...||.||.:.|
 Frog   135 CYSEGVEKLRDMQVLYTNRAQAFIKLEKYENAISDCQWAL-KCNEKCAKAYVHMGKAYLGLKEYS 198

  Fly   206 NFENCVKYARKFNSKQMDFIDDFLEKL 232
            .       |||...|.:| :|..||||
 Frog   199 E-------ARKCYLKLLD-VDPNLEKL 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34297NP_001097696.1 TPR_11 119..185 CDD:290150 29/66 (44%)
TPR repeat 119..147 CDD:276809 12/28 (43%)
TPR repeat 152..183 CDD:276809 14/31 (45%)
TPR repeat 188..216 CDD:276809 8/28 (29%)
ttc12XP_017951452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003602
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.