DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and NRPB12

DIOPT Version :8

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_198917.1 Gene:NRPB12 / 834103 AraportID:AT5G41010 Length:51 Species:Arabidopsis thaliana

Alignment Length:50 Identity:27/50 (54%)
Similarity:38/50 (76%) Gaps:0/50 (0%)


  Fly     8 DNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            |.....:||:||:|..||.::..|.|:||||||||:|||||:|:|.::||
plant     2 DPAPEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR 51

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 25/43 (58%)
NRPB12NP_198917.1 RPOLCX 8..51 CDD:128906 25/43 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2425
OMA 1 1.010
OrthoDB 1 1.010 D1620152at2759
OrthoInspector 1 1.000 T124203
orthoMCL 1 0.900 OOG5_130124
Panther 1 1.100 LDO PTHR12056
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.