DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2K and rpb-12

DIOPT Version :10

Sequence 1:NP_001097319.1 Gene:Polr2K / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_501593.1 Gene:rpb-12 / 184886 WormBaseID:WBGene00009078 Length:62 Species:Caenorhabditis elegans


Alignment Length:45 Identity:32/45 - (71%)
Similarity:41/45 - (91%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            :|.|||||||.|||::|:|.||||||||||:||||.::|:|:|||
 Worm    18 SMIYICGECHAENEIKPKDAIRCRECGYRILYKKRCRKLMVYDAR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2KNP_001097319.1 RPOLCX 14..57 CDD:128906 30/42 (71%)
rpb-12NP_501593.1 RPOLCX 19..62 CDD:128906 30/42 (71%)

Return to query results.
Submit another query.