DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and rpb-12

DIOPT Version :8

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_501593.1 Gene:rpb-12 / 184886 WormBaseID:WBGene00009078 Length:62 Species:Caenorhabditis elegans

Alignment Length:45 Identity:32/46 (70%)
Similarity:41/46 (89%) Gaps:0/46 (0%)


  Fly    13 AMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            :|.|||||||.|||::|:|.||||||||||:||||.::|:|:|||
 Worm    18 SMIYICGECHAENEIKPKDAIRCRECGYRILYKKRCRKLMVYDAR 62

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 31/43 (72%)
rpb-12NP_501593.1 RPOLCX 19..62 CDD:128906 31/43 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227879
eggNOG 1 0.900 E1_COG1996
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3748
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1620152at2759
OrthoFinder 1 1.000 FOG0002810
OrthoInspector 1 1.000 T474582
orthoMCL 1 0.900 OOG5_130124
Panther 1 1.100 LDO PTHR12056
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1178
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.